The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK
YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB02157 Bet v 1.0110 160 1042 258.5 6.4e-71
CAA07323.1 Bet v 1.0117 160 1036 257.0 1.8e-70
CAB02155 Bet v 1.0108 160 1035 256.8 2.1e-70
CAB02158 Bet v 1.0111 160 1020 253.2 2.6e-69
CAA54482 Bet v 1.0102 160 1016 252.2 5e-69
CAA33887 Bet v 1.0101 160 1016 252.2 5e-69
CAB02156 Bet v 1.0109 160 1015 252.0 5.9e-69
CAA54485 Bet v 1.0105 160 1014 251.7 7e-69
CAB02159 Bet v 1.0112 160 1009 250.5 1.6e-68
CAA54489 Bet v 1.0107 160 1008 250.3 1.9e-68
CAB02161 Bet v 1.0114 160 1005 249.6 3.1e-68
CAB02160 Bet v 1.0113 160 1004 249.3 3.7e-68
CAA54487 Bet v 1.0106 160 993 246.7 2.3e-67
CAA54484 Bet v 1.0104 160 987 245.2 6.4e-67
CAA96547 Bet v 1.0115 160 982 244.0 1.5e-66
CAA04827.1 Bet v 1.0116 159 980 243.5 2e-66
CAA54483 Bet v 1.0103 160 976 242.6 4e-66
CAA07329.1 Bet v 1.0118 160 964 239.7 3e-65
ABC41615.1 Bet v 1.0119 150 958 238.2 7.5e-65
P43186 Bet v 1.0204 160 914 227.6 1.3e-61
CAA04828.1 Bet v 1.0206 159 909 226.4 3e-61
Q39427 Bet v 1.0205 160 906 225.6 4.9e-61
CAA54421 Bet v 1.0201 160 904 225.2 6.9e-61
P43184 Bet v 1.0203 160 901 224.4 1.1e-60
CAA54481 Bet v 1.0202 160 892 222.3 5.1e-60
CAA96548 Cor a 1.0201 160 873 217.7 1.2e-58
AAB24432 Aln g 1 160 855 213.3 2.5e-57
P38948 Aln g 1 159 848 211.6 8e-57
ACF75030.1 Bet v 1.0207 150 840 209.8 2.8e-56
CAB02217 Car b 1.0302 161 828 206.8 2.3e-55
CAB02216 Car b 1.0301 161 803 200.8 1.5e-53
P38950 Car b 1 159 796 199.1 4.8e-53
CAB02207 Car b 1.0104 160 796 199.1 4.9e-53
CAB02206 Car b 1.0103 160 796 199.1 4.9e-53
ABZ81040 Car b 1.0109 160 790 197.6 1.3e-52
ABZ81041 Car b 1.0110 160 787 196.9 2.2e-52
ABZ81043 Car b 1.0112 160 786 196.7 2.6e-52
ABZ81042 Car b 1.0111 160 786 196.7 2.6e-52
ADK39021 Ost c 1.0101 160 785 196.4 3.1e-52
CAB02208 Car b 1.0105 160 784 196.2 3.6e-52
ABZ81044 Car b 1.0113 160 783 196.0 4.3e-52
CAA50325 Cor a 1.0103 160 776 194.3 1.4e-51
CAA47357 Car b 1.0102 159 775 194.0 1.6e-51
CAA50328 Cor a 1.0102 160 774 193.8 1.9e-51
CAB02209 Car b 1.0106 160 774 193.8 1.9e-51
P38949 Car b 1 159 773 193.5 2.3e-51
CAA50327 Cor a 1.0101 160 767 192.1 6.3e-51
CAB02213 Car b 1.0107 160 762 190.9 1.4e-50
CAA54696.1 Bet v 1.0301 160 761 190.6 1.7e-50
Q08407 Cor a 1 159 760 190.4 2e-50
CAB02215 Car b 1.0108 160 752 188.5 7.7e-50
CAA50326 Cor a 1.0104 160 750 188.0 1.1e-49
CAA96549 Cor a 1.0301 160 733 183.9 1.9e-48
AAD48405 Cor a 1.0401 161 712 178.8 6.3e-47
CAD10374 Cas s 1 160 709 178.1 1e-46
AAG40331 Cor a 1.0404 161 709 178.1 1e-46
AAG40329 Cor a 1.0402 161 706 177.4 1.7e-46
AAG40330 Cor a 1.0403 161 703 176.6 2.8e-46
CAA96535 Mal d 1.0401 160 683 171.8 8e-45
APD76154 Jug r 5.0101 160 682 171.6 9.4e-45
ACJ23864 Fag s 1.0101 160 676 170.1 2.6e-44
CAA96536 Mal d 1.0402 160 670 168.7 7e-44
CAA96537 Mal d 1.0403 160 666 167.7 1.4e-43
O24248 Pru av 1 160 642 161.9 7.6e-42
O50001 Pru ar 1 160 631 159.2 4.8e-41
Q2I6V8 Pru p 1.0101 160 630 159.0 5.7e-41
CAA96534 Mal d 1.0301 159 625 157.8 1.3e-40
ABZ81046 Que a 1.0301 160 617 155.9 5e-40
AAO25113 Mal d 1.0304 159 611 154.4 1.4e-39
AAK13027 Mal d 1.0302 159 610 154.2 1.6e-39
QOL10866 Que ac 1.0101 159 605 153.0 3.7e-39
B6CQS9 Pru du 1.0101 160 603 152.5 5.2e-39
AUH28179 Que m 1.0101 160 601 152.0 7.3e-39
AAK13028 Mal d 1.0303 159 597 151.0 1.4e-38
AAD26546 Mal d 1.0103 159 596 150.8 1.7e-38
QGS84240 Que i 1.0101 159 595 150.6 2e-38
AAD29671 Mal d 1.0108 159 594 150.3 2.3e-38
CAA88833 Mal d 1.0102 159 593 150.1 2.7e-38
AAD26552 Mal d 1.0104 159 592 149.8 3.2e-38
CAA58646 Mal d 1.0101 159 589 149.1 5.4e-38
AAD26555 Mal d 1.0107 159 589 149.1 5.4e-38
AAD26553 Mal d 1.0105 159 588 148.9 6.3e-38
AAD26554 Mal d 1.0106 159 588 148.9 6.3e-38
AAD26545 Mal d 1.0202 159 585 148.1 1e-37
AAB01362 Mal d 1.0201 159 585 148.1 1e-37
Q3T923 Fra a 1 160 585 148.1 1.1e-37
Q256S7 Fra a 1 160 585 148.1 1.1e-37
AFN42528 Can s 5.0101 161 585 148.1 1.1e-37
O65200 Pyr c 1 159 584 147.9 1.2e-37
AAK13029 Mal d 1.0109 159 583 147.7 1.5e-37
ABZ81045 Que a 1.0201 159 583 147.7 1.5e-37
AAD26548 Mal d 1.0204 159 581 147.2 2e-37
AAD13683 Mal d 1.0206 159 580 146.9 2.4e-37
AAD26547 Mal d 1.0203 159 579 146.7 2.9e-37
AAK13030 Mal d 1.0207 159 579 146.7 2.9e-37
Q256S2 Fra a 1 160 579 146.7 2.9e-37
AAD26558 Mal d 1.0205 159 577 146.2 4e-37
Q256S6 Fra a 1 160 576 146.0 4.8e-37
ABZ81047 Que a 1.0401 160 576 146.0 4.8e-37
CAD32318 Mal d 1.0208 158 572 145.0 9.2e-37
Q256S4 Fra a 1 159 564 143.1 3.5e-36
CAM31909 Act d 8.0101 157 510 130.0 2.9e-32
CAM31908 Act c 8.0101 159 493 125.9 5.1e-31
Q0Z8U9 Rub i 1.0101 137 484 123.9 1.9e-30
CAA42646 Gly m 4 158 473 121.1 1.4e-29
AHC08073 Sola l 4.0101 160 471 120.6 2e-29
NP_001275580 Sola l 4.0201 160 464 118.9 6.6e-29
CAA43637 Pha v 1 156 453 116.3 4e-28
AAQ91847 Ara h 8.0101 157 452 116.0 4.8e-28
CAA43636 Pha v 1 155 448 115.1 9.2e-28
P25985 Pha v 1 155 446 114.6 1.3e-27
CAA75803 Lyc e 4.0101 178 425 109.4 5.3e-26
EF436550 Ara h 8.0201 153 420 108.3 9.8e-26
CAA67246 Pet c PR10 155 411 106.2 4.5e-25
Q2VU97 Vig r 1.0101 155 411 106.2 4.5e-25
P49372 Api g 1 154 408 105.4 7.3e-25
P92918 Api g 1.0201 159 402 104.0 2.1e-24
AAL76932 Dau c 1.0201 154 390 101.1 1.5e-23
AAB92255 Tar o RAP 157 383 99.4 5e-23
CAB03716 Dau c 1.0104 154 370 96.3 4.2e-22
CAB06416 Dau c 1.0105 154 367 95.5 7e-22
BAA13604 Dau c 1.0102 154 366 95.3 8.3e-22
AAB01092 Dau c 1.0101 168 364 94.8 1.3e-21
CAB03715 Dau c 1.0103 154 357 93.1 3.7e-21
Q5ULZ4 Fra a 1.0101 100 234 63.7 1.8e-12
P85126 Que a 1.0101 50 215 59.5 1.6e-11
Q9ZWP8 Vig r 6.0101 155 193 53.5 3.1e-09
Q9S8Q4 Cas s 1 24 114 35.6 0.00012
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 258.5 bits 1042,  Expect = 6e-71
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 257.0 bits 1036,  Expect = 2e-70
 Identities = 159/160 99%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 256.8 bits 1035,  Expect = 2e-70
 Identities = 158/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 253.2 bits 1020,  Expect = 3e-69
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
             G+PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 252.2 bits 1016,  Expect = 5e-69
 Identities = 155/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 252.2 bits 1016,  Expect = 5e-69
 Identities = 156/160 97%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 252.0 bits 1015,  Expect = 6e-69
 Identities = 155/160 96%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 8. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 251.7 bits 1014,  Expect = 7e-69
 Identities = 154/160 96%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 250.5 bits 1009,  Expect = 2e-68
 Identities = 155/160 96%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG+PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 250.3 bits 1008,  Expect = 2e-68
 Identities = 153/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAAR+FKAFILDGD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 11. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 249.6 bits 1005,  Expect = 3e-68
 Identities = 155/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEM ETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 249.3 bits 1004,  Expect = 4e-68
 Identities = 154/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 13. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 246.7 bits 993,  Expect = 2e-67
 Identities = 150/160 93%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKY+YSVIEGGP+GD LEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 14. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 245.2 bits 987,  Expect = 6e-67
 Identities = 149/160 93%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKY+YSVIEGGP+GD LEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 244.0 bits 982,  Expect = 1e-66
 Identities = 151/160 94%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGD LEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 16. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 243.5 bits 980,  Expect = 2e-66
 Identities = 149/159 93%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G PFKYVKDRVDEVDH NFKY+YS+IEGGP+GD LEKISNEIKIVATPDGG +LKISNKY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 17. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 242.6 bits 976,  Expect = 4e-66
 Identities = 148/160 92%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GD LEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 239.7 bits 964,  Expect = 3e-65
 Identities = 147/160 91%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 238.2 bits 958,  Expect = 7e-65
 Identities = 145/150 96%, Positives = 149/150 99%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGF 63
            FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSV+NIEGNGGPGTIKKI+FPEGF
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKYHT 123
            PFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGGC+LKISNKYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGNHEVKAEQVKASKEMGETLLRAVESYLL 153
            KGNHEVKAEQVKASKEMGETLLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 20. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 227.6 bits 914,  Expect = 1e-61
 Identities = 139/160 86%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 21. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 226.4 bits 909,  Expect = 3e-61
 Identities = 138/159 86%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE+ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIK+VATPDGG +LKISNKY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+HE+KAE++KA KE GETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 22. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 225.6 bits 906,  Expect = 5e-61
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIK+VATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE  E LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 225.2 bits 904,  Expect = 7e-61
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 224.4 bits 901,  Expect = 1e-60
 Identities = 137/160 85%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 222.3 bits 892,  Expect = 5e-60
 Identities = 136/160 85%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 217.7 bits 873,  Expect = 1e-58
 Identities = 130/160 81%, Positives = 147/160 91%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE+TSVIPAARLFKAFILDG+NL PKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RV+EVDHTNFKY+Y+VIEGGP+GD +EKI NEIKIVA PDGG +LKISNK
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEV AE++K  KE  E L+RAVE+YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 213.3 bits 855,  Expect = 3e-57
 Identities = 127/160 79%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVD  NFKY++SVIEGG +GD LEK+ NEIKIVA PDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +HTKG+HE+ AEQ+K  KE    LL+AVESYLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 211.6 bits 848,  Expect = 8e-57
 Identities = 126/159 79%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G PFKYVK+RVDEVD  NFKY++SVIEGG +GD LEK+ NEIKIVA PDGG +LKISNK+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+HE+ AEQ+K  KE    LL+AVESYLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 29. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 209.8 bits 840,  Expect = 3e-56
 Identities = 128/150 85%, Positives = 140/150 93%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGF 63
            FNYE+ETTSVIPAARLFKAFIL+GDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPEG 
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKYHT 123
            PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIKIVATPDGG +LKISNKYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGNHEVKAEQVKASKEMGETLLRAVESYLL 153
            KG+HE+KAE++KA KE GE LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 30. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 206.8 bits 828,  Expect = 2e-55
 Identities = 123/160 76%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+NL PKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGGP+GD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 200.8 bits 803,  Expect = 2e-53
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 32. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 199.1 bits 796,  Expect = 5e-53
 Identities = 118/159 74%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G P KYVK+RV+E+DHTNFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 33. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 199.1 bits 796,  Expect = 5e-53
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 34. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 199.1 bits 796,  Expect = 5e-53
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 35. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 197.6 bits 790,  Expect = 1e-52
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 36. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 196.9 bits 787,  Expect = 2e-52
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG V+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 37. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 196.7 bits 786,  Expect = 3e-52
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 38. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 196.7 bits 786,  Expect = 3e-52
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 39. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 196.4 bits 785,  Expect = 3e-52
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 40. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 196.2 bits 784,  Expect = 4e-52
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 41. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 196.0 bits 783,  Expect = 4e-52
 Identities = 115/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 194.3 bits 776,  Expect = 1e-51
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 43. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 194.0 bits 775,  Expect = 2e-51
 Identities = 115/159 72%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 44. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 193.8 bits 774,  Expect = 2e-51
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 45. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 193.8 bits 774,  Expect = 2e-51
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 46. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 193.5 bits 773,  Expect = 2e-51
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQ ISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 47. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 192.1 bits 767,  Expect = 6e-51
 Identities = 113/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 48. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 190.9 bits 762,  Expect = 1e-50
 Identities = 114/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+KIVA P GG +LKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 190.6 bits 761,  Expect = 2e-50
 Identities = 112/160 70%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVI  ARLFK+F+LD DNL PKVAP+ +SS ENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  FKY+K RVDE+DH NFKY YS+IEGGP+GD LEKIS EIKIVA P GG +LKI++K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+  +  E++KA KE G  L++AVE+YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 50. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 190.4 bits 760,  Expect = 2e-50
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 51. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 188.5 bits 752,  Expect = 8e-50
 Identities = 112/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 52. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 188.0 bits 750,  Expect = 1e-49
 Identities = 112/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 183.9 bits 733,  Expect = 2e-48
 Identities = 111/160 69%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIP ARLFK F+LD DNL PKVAP+AI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG PF Y+K +V+E+D+ NF Y YSVIEG  + D LEKI+ EIKIVA+P GG +LK  +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHT G+HE+K EQ+KA KE    L++AVE YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 178.8 bits 712,  Expect = 6e-47
 Identities = 106/159 66%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G  LEKIS EIK+ A P GG  +LKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 178.1 bits 709,  Expect = 1e-46
 Identities = 107/160 66%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS IP  RLFKAF+LD DNL PK+AP+AI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  FKYVK R+DE+D+ NF Y YSVIEG  + ++LEKIS EIKIVA+PDGG +LK ++K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG +E+K E+V A KE    L++AVE+YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 178.1 bits 709,  Expect = 1e-46
 Identities = 105/159 66%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G  LEKI  EIK+ A P GG  +LKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 177.4 bits 706,  Expect = 2e-46
 Identities = 104/159 65%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G  LEKIS EIK+ A P GG  +LKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 176.6 bits 703,  Expect = 3e-46
 Identities = 104/159 65%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G  LEKIS EIK+ A P GG  +LKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 59. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 171.8 bits 683,  Expect = 8e-45
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 171.6 bits 682,  Expect = 9e-45
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 61. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 170.1 bits 676,  Expect = 3e-44
 Identities = 101/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I + LEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 168.7 bits 670,  Expect = 7e-44
 Identities = 100/160 62%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S + IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 167.7 bits 666,  Expect = 1e-43
 Identities = 100/160 62%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            Y  KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 161.9 bits 642,  Expect = 8e-42
 Identities = 93/160 58%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D +D  N+ Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 159.2 bits 631,  Expect = 5e-41
 Identities = 93/160 58%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D++E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 159.0 bits 630,  Expect = 6e-41
 Identities = 92/160 57%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 157.8 bits 625,  Expect = 1e-40
 Identities = 98/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  I + +EKIS E K+VA+   G V+K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 68. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 155.9 bits 617,  Expect = 5e-40
 Identities = 91/159 57%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 69. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 154.4 bits 611,  Expect = 1e-39
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  I + +EKIS E K+VA+   G V+K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 70. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 154.2 bits 610,  Expect = 2e-39
 Identities = 95/159 59%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  I + +EKIS E K+VA    G V+K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 71. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 153.0 bits 605,  Expect = 4e-39
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E    KY K R+D +D  N  Y++SVIEG  + DI   IS E+K VA+PDGG ++K + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDI-ASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 72. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 152.5 bits 603,  Expect = 5e-39
 Identities = 89/160 55%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG+F Y  E+TSVIP  RLFKA++L+ D L PK+APQ++ S E +EG+GG GTIKKISF 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D +D  NF YNYS++EG  + D +EKIS EIK+VA+ DGG V+K ++ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E VKA KE    L++ +E+YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 73. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 152.0 bits 601,  Expect = 7e-39
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +K+ K R+D +D  NF +++SVIEG  + D LE +S E KIVA+PDGG ++K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 74. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 151.0 bits 597,  Expect = 1e-38
 Identities = 93/159 58%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARL+ AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  NF Y YSVIEG  I + +EKIS E K+VA+  G  +  IS+ 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 150.8 bits 596,  Expect = 2e-38
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 76. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 150.6 bits 595,  Expect = 2e-38
 Identities = 92/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E   FKY K R+D +D  N  Y++SVIEG  + D++  +S EIK VA+PDGG + K + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 77. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 150.3 bits 594,  Expect = 2e-38
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 150.1 bits 593,  Expect = 3e-38
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KGN E+K E+VK  KE G  L++ +ESYL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 149.8 bits 592,  Expect = 3e-38
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 149.1 bits 589,  Expect = 5e-38
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VK  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 149.1 bits 589,  Expect = 5e-38
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA K     L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 148.9 bits 588,  Expect = 6e-38
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 148.9 bits 588,  Expect = 6e-38
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +E IS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 148.1 bits 585,  Expect = 1e-37
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 148.1 bits 585,  Expect = 1e-37
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 148.1 bits 585,  Expect = 1e-37
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 87. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 148.1 bits 585,  Expect = 1e-37
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 88. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 148.1 bits 585,  Expect = 1e-37
 Identities = 87/160 54%, Positives = 121/160 75%, Gaps = 1/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS I  ARLFKAF+LDGDNL PK+APQA+  VE +EGNGG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDILEKISNEIKIVATPDGGCVLKISN 119
            +G PFKYVK +++ +D  ++ Y+YS+IEG  + G+ LEKI++E K+VA+ DGG V+K  +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            KY++ G+ +V  E+VK  ++    +L+ VE+YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 89. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 147.9 bits 584,  Expect = 1e-37
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG++ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RVD +D  ++ Y Y++IEG  + D +EKIS E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 147.7 bits 583,  Expect = 1e-37
 Identities = 89/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VK  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 147.7 bits 583,  Expect = 1e-37
 Identities = 90/158 56%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E   FKY K R+D +D  N  Y++SVIEG  +  ++E +S EIK VA+PDGG ++K + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 92. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 147.2 bits 581,  Expect = 2e-37
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K++A+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 146.9 bits 580,  Expect = 2e-37
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFK F+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 146.7 bits 579,  Expect = 3e-37
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ES+L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 146.7 bits 579,  Expect = 3e-37
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGT KKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 96. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 146.7 bits 579,  Expect = 3e-37
 Identities = 84/160 52%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + + +EKI  E K+V+ P GG ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 97. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 146.2 bits 577,  Expect = 4e-37
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 98. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 146.0 bits 576,  Expect = 5e-37
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG + YE E TS IPA +LFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 99. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 146.0 bits 576,  Expect = 5e-37
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG + K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 100. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 145.0 bits 572,  Expect = 9e-37
 Identities = 87/158 55%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GV+ YE E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
            G  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH-Y 119
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+ E+  E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 101. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 143.1 bits 564,  Expect = 4e-36
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 102. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 130.0 bits 510,  Expect = 3e-32
 Identities = 78/156 50%, Positives = 107/156 68%, Gaps = 1/156 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG   Y+ E  S I A ++FKAF+LDGD + PK  P+AI+ V+ +EG+GG GTIK  +F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG   K VK R+D +D  NF Y+YS+IEGG + D++E IS  IKIVATPDGGC+ K  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157
            Y  K + +V  E++KA KE    +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 103. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 125.9 bits 493,  Expect = 5e-31
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 0/157 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 123.9 bits 484,  Expect = 2e-30
 Identities = 74/135 54%, Positives = 97/135 71%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKD 70
            TSVIP  +LFKAF+LD DNL PK+APQA+ SVE IEG+GG GT+KKI + EG    YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVK 130
            ++D +D  NF Y+YS+ EG  +GD +EKIS EIK+VA+  G  ++K ++ YH KG  E+K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGS-IIKTTSHYHCKGGAEIK 120
Query  131  AEQVKASKEMGETLLR 146
             EQVK  KE    L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 121.1 bits 473,  Expect = 1e-29
 Identities = 74/158 46%, Positives = 107/158 67%, Gaps = 2/158 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E  S +  A L+KA++ D DN+ PK A  +  SVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++ +D  N+ Y+YSV+ G  + D  EKI+ + K+VA P+GG   K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            Y TKG+ E   +++K  K   + L++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 120.6 bits 471,  Expect = 2e-29
 Identities = 72/159 45%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 118.9 bits 464,  Expect = 7e-29
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 116.3 bits 453,  Expect = 4e-28
 Identities = 68/155 43%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +  EKI+ + K+   P+GG ++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 109. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 116.0 bits 452,  Expect = 5e-28
 Identities = 70/157 44%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E    K++  +V+ +D  N+ YNYSV+ G  +    EKI+ E K+V  P+GG + K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 115.1 bits 448,  Expect = 9e-28
 Identities = 69/154 44%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++E+D  N+ Y+YS++ G  + D  EKIS + K+   P+GG V+K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 114.6 bits 446,  Expect = 1e-27
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
                K+V  +++ +D  N+ Y+YS++ G  + +  EKI+ + K+   P+GG ++K+S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 109.4 bits 425,  Expect = 5e-26
 Identities = 64/150 42%, Positives = 95/150 63%, Gaps = 0/150 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVES 150
            YHTKG+H V  E+    +      ++   S
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQGCRS 150

Sequence Alignment: 113. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 108.3 bits 420,  Expect = 1e-25
 Identities = 64/153 41%, Positives = 102/153 66%, Gaps = 2/153 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E+TS +P A+LFKA ++DGD L PK+ P AI S+E +EGNGGPGT+KK++  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E     YV  ++D +D   + Y+Y++  G    +ILEK+S + K+ A  DGG  +K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  +  E  +  K+  + +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 114. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 106.2 bits 411,  Expect = 4e-25
 Identities = 61/155 39%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 115. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 106.2 bits 411,  Expect = 4e-25
 Identities = 66/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF ++ + TS +  A L+ A+  D DN+ PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++ VD  N+ Y+YS++ G  + D  EKI+ + KI    DGG ++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            YH KG+     +++KA K   + L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 105.4 bits 408,  Expect = 7e-25
 Identities = 62/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 104.0 bits 402,  Expect = 2e-24
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV     E  S + A ++++ F+LD D +FPKV PQ I SVE +EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E   +  +K +VD +D   + Y Y+ I G  + D+LE + NE  +V T DGGC++K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            Y+TKG+  +  +++K + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 101.1 bits 390,  Expect = 1e-23
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E E  S + A ++++ F+LD D +FPKV PQ I SVE +EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E   +  +K +VD +D   + Y Y+ I G  + + LE + N+  +V T DGGC++K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            Y+TKG+  +  ++VK + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 99.4 bits 383,  Expect = 5e-23
 Identities = 56/152 36%, Positives = 94/152 61%, Gaps = 0/152 0%
Query  7    ETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFK 66
            E E TS +  + +FKAF++D D + PK  P+   S++ IEG+GG GTIK I++ +G PF 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKYHTKGN 126
              K +VD +D  NF  +Y++ EG  +  I+E  ++ +K + + DGG V K S  +  KG+
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158
             ++  E V   KE  +  ++A+E+Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 96.3 bits 370,  Expect = 4e-22
 Identities = 56/154 36%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 95.5 bits 367,  Expect = 7e-22
 Identities = 56/154 36%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 95.3 bits 366,  Expect = 8e-22
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 94.8 bits 364,  Expect = 1e-21
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 93.1 bits 357,  Expect = 4e-21
 Identities = 55/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 63.7 bits 234,  Expect = 2e-12
 Identities = 50/100 50%, Positives = 67/100 67%, Gaps = 39/100 39%
Query  22   AFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFK 81
            AF+LD DNL PK                      KI+F EG  + YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMG 141
                 +EG  + D LEKI  E K+V+ P    ++K ++KYHTKG+ E+K E+VKA KE  
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  ETLLRAVESYLLAHSDAYN 160
              L++ +E YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 59.5 bits 215,  Expect = 2e-11
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 53.5 bits 193,  Expect = 3e-09
 Identities = 47/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152
            Y    + E K    K S+      LR +E YL
Sbjct  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 35.6 bits 114,  Expect = 0.0001
 Identities = 17/24 70%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYETETTSVIPAARLFKAFIL 25
            GVF +E++ TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.