The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG
EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK
FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA50326 Cor a 1.0104 160 1020 210.3 2.1e-56
CAA50328 Cor a 1.0102 160 997 205.8 4.8e-55
CAA50327 Cor a 1.0101 160 984 203.2 2.8e-54
Q08407 Cor a 1 159 977 201.8 7.3e-54
CAA50325 Cor a 1.0103 160 963 199.1 5e-53
ABZ81040 Car b 1.0109 160 938 194.1 1.5e-51
ABZ81041 Car b 1.0110 160 935 193.5 2.3e-51
ABZ81043 Car b 1.0112 160 934 193.3 2.6e-51
ADK39021 Ost c 1.0101 160 933 193.1 3e-51
ABZ81044 Car b 1.0113 160 930 192.6 4.5e-51
ABZ81042 Car b 1.0111 160 929 192.4 5.2e-51
CAB02206 Car b 1.0103 160 922 191.0 1.3e-50
CAB02209 Car b 1.0106 160 922 191.0 1.3e-50
CAB02207 Car b 1.0104 160 921 190.8 1.5e-50
CAB02213 Car b 1.0107 160 919 190.4 2e-50
CAA47357 Car b 1.0102 159 916 189.8 3e-50
CAB02208 Car b 1.0105 160 910 188.6 6.9e-50
CAB02215 Car b 1.0108 160 909 188.4 7.9e-50
P38949 Car b 1 159 898 186.3 3.5e-49
P38950 Car b 1 159 858 178.4 8.4e-47
AAB24432 Aln g 1 160 795 166.0 4.6e-43
CAB02216 Car b 1.0301 161 794 165.8 5.3e-43
Q39427 Bet v 1.0205 160 791 165.2 7.9e-43
CAA96548 Cor a 1.0201 160 790 165.0 9.1e-43
CAB02217 Car b 1.0302 161 790 165.0 9.2e-43
P38948 Aln g 1 159 788 164.6 1.2e-42
P43186 Bet v 1.0204 160 787 164.4 1.4e-42
CAA54421 Bet v 1.0201 160 782 163.4 2.7e-42
P43184 Bet v 1.0203 160 780 163.0 3.6e-42
CAA04828.1 Bet v 1.0206 159 777 162.4 5.3e-42
CAA54481 Bet v 1.0202 160 771 161.2 1.2e-41
CAB02160 Bet v 1.0113 160 768 160.6 1.8e-41
CAB02159 Bet v 1.0112 160 763 159.6 3.6e-41
CAA54484 Bet v 1.0104 160 763 159.6 3.6e-41
CAA33887 Bet v 1.0101 160 763 159.6 3.6e-41
CAB02156 Bet v 1.0109 160 762 159.5 4.2e-41
CAB02161 Bet v 1.0114 160 761 159.3 4.8e-41
CAA54487 Bet v 1.0106 160 759 158.9 6.3e-41
CAA54482 Bet v 1.0102 160 757 158.5 8.3e-41
CAA54483 Bet v 1.0103 160 754 157.9 1.2e-40
CAA54489 Bet v 1.0107 160 752 157.5 1.6e-40
CAA07323.1 Bet v 1.0117 160 752 157.5 1.6e-40
CAA07329.1 Bet v 1.0118 160 751 157.3 1.9e-40
CAB02155 Bet v 1.0108 160 751 157.3 1.9e-40
CAB02157 Bet v 1.0110 160 750 157.1 2.1e-40
CAA54485 Bet v 1.0105 160 746 156.3 3.7e-40
CAA04827.1 Bet v 1.0116 159 745 156.1 4.2e-40
CAB02158 Bet v 1.0111 160 743 155.7 5.6e-40
CAA96547 Bet v 1.0115 160 741 155.3 7.3e-40
ACF75030.1 Bet v 1.0207 150 729 153.0 3.5e-39
CAA54696.1 Bet v 1.0301 160 695 146.2 3.9e-37
ABC41615.1 Bet v 1.0119 150 692 145.7 5.5e-37
CAA96549 Cor a 1.0301 160 664 140.1 2.7e-35
CAA96535 Mal d 1.0401 160 656 138.6 8.1e-35
ACJ23864 Fag s 1.0101 160 655 138.4 9.3e-35
APD76154 Jug r 5.0101 160 653 138.0 1.2e-34
CAA96536 Mal d 1.0402 160 643 136.0 4.8e-34
AAD48405 Cor a 1.0401 161 643 136.0 4.8e-34
AAG40331 Cor a 1.0404 161 643 136.0 4.8e-34
CAD10374 Cas s 1 160 640 135.4 7.2e-34
CAA96537 Mal d 1.0403 160 639 135.2 8.2e-34
AAG40329 Cor a 1.0402 161 639 135.2 8.3e-34
AAG40330 Cor a 1.0403 161 636 134.6 1.3e-33
ABZ81046 Que a 1.0301 160 611 129.7 3.8e-32
Q2I6V8 Pru p 1.0101 160 605 128.5 8.6e-32
O24248 Pru av 1 160 603 128.1 1.1e-31
AUH28179 Que m 1.0101 160 588 125.2 8.7e-31
CAA96534 Mal d 1.0301 159 581 123.8 2.3e-30
Q256S7 Fra a 1 160 580 123.6 2.6e-30
Q3T923 Fra a 1 160 580 123.6 2.6e-30
O50001 Pru ar 1 160 577 123.0 3.9e-30
ABZ81047 Que a 1.0401 160 576 122.8 4.5e-30
Q256S2 Fra a 1 160 574 122.4 5.9e-30
AAK13027 Mal d 1.0302 159 573 122.2 6.7e-30
Q256S6 Fra a 1 160 571 121.8 8.9e-30
AAO25113 Mal d 1.0304 159 568 121.2 1.3e-29
AAD26546 Mal d 1.0103 159 564 120.4 2.3e-29
AAD29671 Mal d 1.0108 159 562 120.0 3e-29
AAD26552 Mal d 1.0104 159 560 119.6 4e-29
B6CQS9 Pru du 1.0101 160 560 119.6 4e-29
Q256S4 Fra a 1 159 559 119.5 4.6e-29
O65200 Pyr c 1 159 559 119.5 4.6e-29
CAA58646 Mal d 1.0101 159 558 119.3 5.2e-29
AAD26545 Mal d 1.0202 159 558 119.3 5.2e-29
AAB01362 Mal d 1.0201 159 558 119.3 5.2e-29
AAD26555 Mal d 1.0107 159 557 119.1 6e-29
AAD13683 Mal d 1.0206 159 557 119.1 6e-29
AAD26554 Mal d 1.0106 159 556 118.9 6.9e-29
AAK13028 Mal d 1.0303 159 556 118.9 6.9e-29
AAD26553 Mal d 1.0105 159 556 118.9 6.9e-29
AAD26548 Mal d 1.0204 159 554 118.5 9e-29
AAK13029 Mal d 1.0109 159 552 118.1 1.2e-28
AAD26547 Mal d 1.0203 159 552 118.1 1.2e-28
AAK13030 Mal d 1.0207 159 552 118.1 1.2e-28
CAD32318 Mal d 1.0208 158 551 117.9 1.3e-28
AFN42528 Can s 5.0101 161 551 117.9 1.4e-28
CAA88833 Mal d 1.0102 159 550 117.7 1.6e-28
AAD26558 Mal d 1.0205 159 550 117.7 1.6e-28
ABZ81045 Que a 1.0201 159 542 116.1 4.6e-28
QGS84240 Que i 1.0101 159 537 115.1 9.2e-28
QOL10866 Que ac 1.0101 159 533 114.3 1.6e-27
CAM31908 Act c 8.0101 159 524 112.6 5.4e-27
CAM31909 Act d 8.0101 157 489 105.7 6.4e-25
Q0Z8U9 Rub i 1.0101 137 472 102.3 5.5e-24
CAA42646 Gly m 4 158 469 101.7 9.9e-24
NP_001275580 Sola l 4.0201 160 443 96.6 3.5e-22
AHC08073 Sola l 4.0101 160 442 96.4 4e-22
CAA43637 Pha v 1 156 434 94.8 1.2e-21
CAA43636 Pha v 1 155 432 94.4 1.5e-21
P25985 Pha v 1 155 427 93.4 3e-21
AAQ91847 Ara h 8.0101 157 413 90.7 2.1e-20
EF436550 Ara h 8.0201 153 400 88.1 1.2e-19
CAA75803 Lyc e 4.0101 178 400 88.1 1.4e-19
P92918 Api g 1.0201 159 397 87.5 1.9e-19
Q2VU97 Vig r 1.0101 155 393 86.7 3.1e-19
AAL76932 Dau c 1.0201 154 392 86.6 3.5e-19
CAA67246 Pet c PR10 155 387 85.6 7.1e-19
AAB92255 Tar o RAP 157 378 83.8 2.5e-18
P49372 Api g 1 154 372 82.6 5.4e-18
CAB03716 Dau c 1.0104 154 367 81.6 1.1e-17
CAB06416 Dau c 1.0105 154 364 81.0 1.6e-17
BAA13604 Dau c 1.0102 154 361 80.4 2.4e-17
AAB01092 Dau c 1.0101 168 359 80.0 3.6e-17
CAB03715 Dau c 1.0103 154 352 78.7 8.4e-17
Q5ULZ4 Fra a 1.0101 100 246 57.9 9.8e-11
P85126 Que a 1.0101 50 187 46.4 1.4e-07
Q9ZWP8 Vig r 6.0101 155 156 40.0 3.6e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 210.3 bits 1020,  Expect = 2e-56
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 2. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 205.8 bits 997,  Expect = 5e-55
 Identities = 157/160 98%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYEVETPSVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGS LKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 3. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 203.2 bits 984,  Expect = 3e-54
 Identities = 155/160 96%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYEVETPSVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGS LKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 4. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 201.8 bits 977,  Expect = 7e-54
 Identities = 154/159 96%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYEVETPSVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            GSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGS LKISSKF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 5. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 199.1 bits 963,  Expect = 5e-53
 Identities = 152/160 95%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGS LKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 194.1 bits 938,  Expect = 2e-51
 Identities = 145/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS LKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 193.5 bits 935,  Expect = 2e-51
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 193.3 bits 934,  Expect = 3e-51
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 9. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 193.1 bits 933,  Expect = 3e-51
 Identities = 144/160 90%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+ VENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS LKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 192.6 bits 930,  Expect = 5e-51
 Identities = 144/160 90%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +K+VKERVDEVDN NFKYSYTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 11. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 192.4 bits 929,  Expect = 5e-51
 Identities = 143/160 89%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 12. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 191.0 bits 922,  Expect = 1e-50
 Identities = 142/160 88%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 13. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 191.0 bits 922,  Expect = 1e-50
 Identities = 143/160 89%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLD DKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 14. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 190.8 bits 921,  Expect = 2e-50
 Identities = 142/160 88%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGD LEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 15. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 190.4 bits 919,  Expect = 2e-50
 Identities = 143/160 89%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLD DKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFK+SYTVIEGDVLGDKLEKV  ELKIVAAPGGGS LKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 16. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 189.8 bits 916,  Expect = 3e-50
 Identities = 142/159 89%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            GS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSKF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 17. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 188.6 bits 910,  Expect = 7e-50
 Identities = 141/160 88%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFKSYVLD DKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 18. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 188.4 bits 909,  Expect = 8e-50
 Identities = 141/160 88%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSV+ AARLFKSYVLD DKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K+VKERVDEVDN NFK+SYTVIEGDVLGDKLEKV  EL IVAAPGGGS LKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 19. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 186.3 bits 898,  Expect = 4e-49
 Identities = 139/159 87%, Positives = 148/159 93%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQ I+SVENVGGNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            G  +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSKF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAE+MKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 178.4 bits 858,  Expect = 8e-47
 Identities = 132/159 83%, Positives = 147/159 92%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYE ET SVI AARLFK+++LDG+KLIPKV+PQA++SVENV GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            GS  KYVKERV+E+D+TNFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSKF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 166.0 bits 795,  Expect = 5e-43
 Identities = 120/160 75%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ETPSVI AARLFK+++LDGDKL+PKVAP+A++SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERVDEVD  NFKYS++VIEG  +GD LEKVC+E+KIVAAP GGS LKIS+K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FH KGDHEINAE++K  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 165.8 bits 794,  Expect = 5e-43
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDG+KLIPKV+PQA++SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS  KYVKERV+EVD+TNFKYSYTVIEG  +GDK+EK+C+E+KIVAAP GGS LKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 165.2 bits 791,  Expect = 8e-43
 Identities = 119/160 74%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+K+VA P GGS LKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE AE LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 165.0 bits 790,  Expect = 9e-43
 Identities = 118/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E+ SVI AARLFK+++LDG+ LIPKVAPQA++SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERV+EVD+TNFKYSYTVIEG  +GDK+EK+C+E+KIVAAP GGS LKIS+K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE++AE +KG KE  E L+RAVE YLLAHS  YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 165.0 bits 790,  Expect = 9e-43
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDG+ LIPKVAPQA++SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS  KYVKERV+EVD+TNFKYSYTVIEG  +GDK+EK+C+E+KIVAAP GGS LKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 26. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 164.6 bits 788,  Expect = 1e-42
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYE ETPSVI AARLFK+++LDGDKL+PKVAP+A++SVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            GS +KYVKERVDEVD  NFKYS++VIEG  +GD LEKVC+E+KIVAAP GGS LKIS+KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHEINAE++K  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 27. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 164.4 bits 787,  Expect = 1e-42
 Identities = 119/160 74%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGS LKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 163.4 bits 782,  Expect = 3e-42
 Identities = 118/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++L+GD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGS LKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 163.0 bits 780,  Expect = 4e-42
 Identities = 118/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++L+GD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGS LKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 162.4 bits 777,  Expect = 5e-42
 Identities = 117/159 73%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYE ET SVI AARLFK+++LDGD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            GS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+K+VA P GGS LKIS+K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 31. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 161.2 bits 771,  Expect = 1e-41
 Identities = 117/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++L+GD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGS LKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 160.6 bits 768,  Expect = 2e-41
 Identities = 114/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L+PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GGS LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 159.6 bits 763,  Expect = 4e-41
 Identities = 114/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GGS LKIS+K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 159.6 bits 763,  Expect = 4e-41
 Identities = 113/160 70%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE+E  SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKYSY+VIEG  +GD LEK+ +E+KIVA P GGS LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 159.6 bits 763,  Expect = 4e-41
 Identities = 114/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GGS LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 159.5 bits 762,  Expect = 4e-41
 Identities = 114/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GGS LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 159.3 bits 761,  Expect = 5e-41
 Identities = 114/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GGS LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 158.9 bits 759,  Expect = 6e-41
 Identities = 113/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKYSY+VIEG  +GD LEK+ +E+KIVA P GGS LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 158.5 bits 757,  Expect = 8e-41
 Identities = 112/160 70%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE+ET SVI AARLFK+++LDGD L+PKVAPQAI+SVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 157.9 bits 754,  Expect = 1e-40
 Identities = 113/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK RVDEVD+TNFKYSY+VIEG  +GD LEK+ +E+KIVA P GGS LKI++K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 157.5 bits 752,  Expect = 2e-40
 Identities = 111/160 69%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI AAR+FK+++LDGDKL+PKVAPQAI+SVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 157.5 bits 752,  Expect = 2e-40
 Identities = 112/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 157.3 bits 751,  Expect = 2e-40
 Identities = 113/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD LIPKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+K+VA P GGS L+IS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 157.3 bits 751,  Expect = 2e-40
 Identities = 112/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 157.1 bits 750,  Expect = 2e-40
 Identities = 112/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 156.3 bits 746,  Expect = 4e-40
 Identities = 112/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++L+GD LIPKVAPQAI+SVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 156.1 bits 745,  Expect = 4e-40
 Identities = 111/159 69%, Positives = 133/159 83%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVFNYE E  SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            G  +KYVK+RVDEVD+ NFKYSY++IEG  +GD LEK+ +E+KIVA P GGS LKIS+K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 48. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 155.7 bits 743,  Expect = 6e-40
 Identities = 111/160 69%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
             G  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 155.3 bits 741,  Expect = 7e-40
 Identities = 112/160 70%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG  +KYVK+RVDEV + NFKYSY+VIEG  +GD LEK+ +E+KIVA P G S LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 153.0 bits 729,  Expect = 4e-39
 Identities = 110/150 73%, Positives = 127/150 84%, Gaps = 0/150 0%
Query  4    FNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGEGS 63
            FNYE ET SVI AARLFK+++L+GD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   RYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKFHA 123
             +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGS LKIS+K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEINAEEMKGAKEMAEKLLRAVETYLL 153
            KGDHE+ AE MK  KE  E LLRAVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 146.2 bits 695,  Expect = 4e-37
 Identities = 104/160 65%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI+ ARLFKS+VLD D LIPKVAP+ ++S EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +KY+K RVDE+D+ NFKY Y++IEG  LGD LEK+  E+KIVAAPGGGS LKI+SK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD  +N EE+K  KE    L++AVE YL+AH   YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 145.7 bits 692,  Expect = 5e-37
 Identities = 103/150 68%, Positives = 126/150 84%, Gaps = 0/150 0%
Query  4    FNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGEGS 63
            FNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SV+N+ GNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   RYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKFHA 123
             +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEINAEEMKGAKEMAEKLLRAVETYLL 153
            KG+HE+ AE++K +KEM E LLRAVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 140.1 bits 664,  Expect = 3e-35
 Identities = 101/160 63%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI  ARLFK +VLD D LIPKVAP+AI S+E + GNGGPGTIK I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS + Y+K++V+E+D  NF Y Y+VIEGD L DKLEK+  E+KIVA+P GGS LK  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H  GDHE+  E++K  KE A  L++AVE YLLAHS  YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 138.6 bits 656,  Expect = 8e-35
 Identities = 98/160 61%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE ET SVI A RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK+RV+ +D  NF YSY++IEGD L DKLEK+  E K++A+P GGS +K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 138.4 bits 655,  Expect = 9e-35
 Identities = 97/160 60%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE ET +VI+ ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS++ YVK R+DE+DN NF Y+ T+IEGD + + LEK+  E+K+VA+P GGS LK +SK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 56. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 138.0 bits 653,  Expect = 1e-34
 Identities = 100/160 62%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E+ SVI  ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+YKYVK R D +D  NF Y+Y+VIEGD L DK+EK+  E KIVA+  GGS LK  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 57. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 136.0 bits 643,  Expect = 5e-34
 Identities = 96/160 60%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI A RLFK+++LDGD LIPK+APQAI S + + G+GG GTIK +TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK+RV+ +D  NF YSY++IEGD L DKLEK+  E K++A+P GGS +K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 136.0 bits 643,  Expect = 5e-34
 Identities = 100/159 62%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI  ARLFKS+VLD D LIPKVAPQ  TS EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAP-GGGSTLKISS 119
            EG+ +KY+K +V+E+D+ NFKY Y++IEG  LG  LEK+  E+K+ AAP GGGS LKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  IN EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 59. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 136.0 bits 643,  Expect = 5e-34
 Identities = 100/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF+YE E  SVI  ARLFKS+VLD D LIPKVAPQ  TS EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAP-GGGSTLKISS 119
            EG+ +KY+K +V+E+D+ NFKY Y++IEG  LG  LEK+  E+K+ AAP GGGS LKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  IN EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 60. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 135.4 bits 640,  Expect = 7e-34
 Identities = 97/160 60%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF +E E  S I   RLFK++VLD D LIPK+AP+AI S E + GNGGPGTIK ITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS++KYVK R+DE+D  NF Y Y+VIEGDV+ + LEK+  E+KIVA+P GGS LK +SK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG++EI  E++   KE A  L++AVE YLLAHS  YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 135.2 bits 639,  Expect = 8e-34
 Identities = 96/160 60%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI A RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK+RV+ +D  NF YSY++IEGD L DKLEK+  E K++A+P GGS +K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            + AKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 135.2 bits 639,  Expect = 8e-34
 Identities = 99/159 62%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF+YE E  SVI  ARLFKS+VLD D LIPKVAPQ  T  EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAP-GGGSTLKISS 119
            EGS +KY+K +V+E+D+ NFKY Y++IEG  LG  LEK+  E+K+ AAP GGGS LKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  I+ EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 134.6 bits 636,  Expect = 1e-33
 Identities = 99/159 62%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI  ARLFKS+VLD D LIPKVAPQ  T  EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAP-GGGSTLKISS 119
            EGS +KY+K +V+E+D+ NFKY Y++IEG  LG  LEK+  E+K+ AAP GGGS LKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  I+ EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 129.7 bits 611,  Expect = 4e-32
 Identities = 93/159 58%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI  ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS  K+ K R+D +D  NF YS++VIEGD L DKLE V +E KIVA+P GGS +K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 128.5 bits 605,  Expect = 9e-32
 Identities = 91/160 56%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  S I   RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D +D  N  YSYT+IEGD LGD LEK+  E K+VA+P GGS +K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 128.1 bits 603,  Expect = 1e-31
 Identities = 90/160 56%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  S I   RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D +D  N+ YSYT+IEGD LGD LEK+  E K+VA+P GGS +K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 125.2 bits 588,  Expect = 9e-31
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  YE E  SVI  ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS  K+ K R+D +D  NF +S++VIEGD L DKLE V +E KIVA+P GGS +K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E ++G KE A  +++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 68. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 123.8 bits 581,  Expect = 2e-30
 Identities = 90/159 56%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVFNYE E  SVI  ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS +K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 69. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 123.6 bits 580,  Expect = 3e-30
 Identities = 87/160 54%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ YE E  S I A +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP GG+ +K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 70. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 123.6 bits 580,  Expect = 3e-30
 Identities = 86/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ YE E  S I A +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP GG+ +K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 71. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 123.0 bits 577,  Expect = 4e-30
 Identities = 87/160 54%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI   +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK RVD +D  N+ YSYT+IEGD L D +E +  ++K+VA+P GGS +K +S 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 72. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 122.8 bits 576,  Expect = 5e-30
 Identities = 90/159 56%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF +E +  SVI+ ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS  K+ K R+D +D  NF YS++VIEGD L DKLE V +E KIVA+P GGS  K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E ++G KE A  +++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 73. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 122.4 bits 574,  Expect = 6e-30
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ YE E  S I A +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L + +EK+  E K+V+AP GG+ +K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 74. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 122.2 bits 573,  Expect = 7e-30
 Identities = 89/159 55%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI  ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VAA G GS +K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 75. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 121.8 bits 571,  Expect = 9e-30
 Identities = 86/160 53%, Positives = 111/160 69%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG + YE E  S I A +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP GG+ +K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 76. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 121.2 bits 568,  Expect = 1e-29
 Identities = 88/159 55%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI  ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS +K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 77. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 120.4 bits 564,  Expect = 2e-29
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 120.0 bits 562,  Expect = 3e-29
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 119.6 bits 560,  Expect = 4e-29
 Identities = 87/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 80. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 119.6 bits 560,  Expect = 4e-29
 Identities = 83/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG+F Y  E+ SVI   RLFK+ VL+ D LIPK+APQ++ S E V G+GG GTIK I+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++D +D  NF Y+Y+++EGD L DK+EK+  E+K+VA+  GGS +K +S 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E++K  KE A  L++ +E YL+A+   YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 81. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 119.5 bits 559,  Expect = 5e-29
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ YE E  S I A +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP G + +K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 82. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 119.5 bits 559,  Expect = 5e-29
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG++ +E E  S I   RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK RVD +D  ++ Y+YT+IEGD L D +EK+  E K+VA+ G GST+K  S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 119.3 bits 558,  Expect = 5e-29
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 119.3 bits 558,  Expect = 5e-29
 Identities = 87/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 119.3 bits 558,  Expect = 5e-29
 Identities = 87/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 119.1 bits 557,  Expect = 6e-29
 Identities = 86/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  K  A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 119.1 bits 557,  Expect = 6e-29
 Identities = 87/159 54%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK +VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 88. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 118.9 bits 556,  Expect = 7e-29
 Identities = 86/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +E +  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 118.9 bits 556,  Expect = 7e-29
 Identities = 86/159 54%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  SVI  ARL+ ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS Y YVK ++D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS +K  S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 118.9 bits 556,  Expect = 7e-29
 Identities = 87/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 118.5 bits 554,  Expect = 9e-29
 Identities = 86/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K++A+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 92. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 118.1 bits 552,  Expect = 1e-28
 Identities = 87/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 118.1 bits 552,  Expect = 1e-28
 Identities = 86/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E++L  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 118.1 bits 552,  Expect = 1e-28
 Identities = 86/159 54%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGT K ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 117.9 bits 551,  Expect = 1e-28
 Identities = 87/158 55%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GV+ YE E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
            GS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 96. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 117.9 bits 551,  Expect = 1e-28
 Identities = 81/160 50%, Positives = 117/160 73%, Gaps = 1/160 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF YE E  S I+ ARLFK++VLDGD L+PK+APQA+  VE + GNGG GTIK ITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVL-GDKLEKVCSELKIVAAPGGGSTLKISS 119
            +G  +KYVK +++ +D  ++ YSY++IEGD L G++LEK+  E K+VA+  GG+ +K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            K+++ GD ++N E++K  ++ A ++L+ VE YL  H   YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 97. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 117.7 bits 550,  Expect = 2e-28
 Identities = 85/159 53%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G G+T+K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGATIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE    L++ +E+YL  H   YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 117.7 bits 550,  Expect = 2e-28
 Identities = 86/159 54%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 99. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 116.1 bits 542,  Expect = 5e-28
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF +E +  SVI+ ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E S++KY K R+D +D  N  YS++VIEGD L   +E V +E+K VA+P GGS +K ++K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 100. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 115.1 bits 537,  Expect = 9e-28
 Identities = 84/158 53%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  +E +  SVI  ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E S++KY K R+D +D  N  YS++VIEGD L D +  V +E+K VA+P GGS  K ++K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 101. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 114.3 bits 533,  Expect = 2e-27
 Identities = 81/159 50%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV+NYE +  SVI  ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E S+ KY K R+D +D  N  YS++VIEG+ L D +  + +E+K VA+P GGS +K ++K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            ++ KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 112.6 bits 524,  Expect = 5e-27
 Identities = 78/155 50%, Positives = 112/155 72%, Gaps = 0/155 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  Y++E PS +   +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K VK+RVD +D  N+ YSYT+IEGDVL +K+E +   +KIVA P GGS  K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +  KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 105.7 bits 489,  Expect = 6e-25
 Identities = 77/154 50%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG   Y++E PS ISA ++FK++VLDGD +IPK  P+AIT V+ + G+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS +K VK R+D +D  NF YSY++IEG  L D +E +   +KIVA P GG   K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +  K D +++ EE+K  KE A  +++ VE YLLA+
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 102.3 bits 472,  Expect = 6e-24
 Identities = 70/134 52%, Positives = 98/134 73%, Gaps = 1/134 0%
Query  12   SVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGEGSRYKYVKER 71
            SVI   +LFK++VLD D LIPK+APQA+ SVE + G+GG GT+K I +GEG+ + YVK +
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   VDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKFHAKGDHEINA 131
            +D +D  NF YSY++ EGD LGDK+EK+  E+K+VA+ G GS +K +S +H KG  EI  
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  EEMKGAKEMAEKLLR 146
            E++K  KE A  L++
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 101.7 bits 469,  Expect = 1e-23
 Identities = 76/158 48%, Positives = 104/158 65%, Gaps = 2/158 1%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF +E E  S ++ A L+K+ V D D +IPK A  +  SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E    K+V  +++ +D  N+ YSY+V+ G  L D  EK+  + K+VA P GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +  KGD E N +E+K  K  A+ L++A+E YLLAH  +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 96.6 bits 443,  Expect = 3e-22
 Identities = 68/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  +  E+ + I+  RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE +  ++K  AA  GG   K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 96.4 bits 442,  Expect = 4e-22
 Identities = 65/159 40%, Positives = 101/159 63%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  Y  E+ + IS  RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG   KY+K ++  +D+ N++  Y++IEGD+LG+KLE +  ++K  A   GG   K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 94.8 bits 434,  Expect = 1e-21
 Identities = 65/155 41%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF +E +T S ++ A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS +K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 94.4 bits 432,  Expect = 2e-21
 Identities = 66/154 42%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            M VF +E +T S ++ A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS +K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 93.4 bits 427,  Expect = 3e-21
 Identities = 64/154 41%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            GVF +E +T S ++ A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS +K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 90.7 bits 413,  Expect = 2e-20
 Identities = 65/157 41%, Positives = 97/157 61%, Gaps = 2/157 1%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGVF +E E  S +  A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGS  K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 88.1 bits 400,  Expect = 1e-19
 Identities = 64/153 41%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  +E E+ S +  A+LFK+ V+DGD+L PK+ P AI S+E V GNGGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E  +  YV  ++D +D   + Y YT+  G  + + LEKV  + K+ AA GG S +K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGG-SKIKVSVT 118
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 88.1 bits 400,  Expect = 1e-19
 Identities = 59/142 41%, Positives = 91/142 64%, Gaps = 1/142 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  Y  E+ + IS  RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EG   KY+K ++  +D+ N++  Y++IEGD+LG+KLE +  ++K  A   GG   K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEINAEEMK-GAKEMAE 142
            +H KGDH ++ EE   G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 114. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 87.5 bits 397,  Expect = 2e-19
 Identities = 63/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV    VE PS +SA ++++ ++LD D + PKV PQ I SVE + G+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E + Y  +K++VD +D   + Y+YT I GD+L D LE V +E+ +V    GG  +K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 86.7 bits 393,  Expect = 3e-19
 Identities = 63/154 40%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            M VF ++ +  S ++ A L+ +   D D +IPK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E    K+V  +++ VD  N+ YSY+++ G  L D  EK+  + KI     GGS +K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +H KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 86.6 bits 392,  Expect = 4e-19
 Identities = 61/154 39%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV   EVE PS +SA ++++ ++LD D + PKV PQ I SVE + G+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            E + Y  +K++VD +D   + Y+YT I GD+L + LE V +++ +V    GG  +K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 85.6 bits 387,  Expect = 7e-19
 Identities = 61/155 39%, Positives = 96/155 61%, Gaps = 0/155 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV   EV   S + AA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            + S YK +K+++D +D   F +SY++I+GD+L   ++ + + L  V    GG T   ++ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            F+ KGD  +  E +K A +    +++AVE YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 83.8 bits 378,  Expect = 2e-18
 Identities = 58/149 38%, Positives = 91/149 61%, Gaps = 0/149 0%
Query  7    EVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGEGSRYK 66
            E E  S +S + +FK++V+D D + PK  P+   S++ + G+GG GTIK+IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKFHAKGD 126
              K +VD +D+ NF  SYT+ EGDVL   +E     LK + +  GGS  K S  F  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEINAEEMKGAKEMAEKLLRAVETYLLAH 155
             ++  E +   KE  +K ++A+ETY+++H
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 82.6 bits 372,  Expect = 5e-18
 Identities = 59/154 38%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MGV  + +E  S +SA ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            +G     +  R+D V+   + + Y+VI+GD+L   +E + + + +V    GGS  K ++ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 81.6 bits 367,  Expect = 1e-17
 Identities = 62/154 40%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG  ++ +E  S +SA ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS    +  R D V+   + Y  TVI+GD+L   +E + + L +V    GGS  K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 81.0 bits 364,  Expect = 2e-17
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG  ++ +E  S +SA ++F   VLD D +IPK AP A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS    +  R D V+   + Y  TVI+GD+L   +E + + L +V    GGS  K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 80.4 bits 361,  Expect = 2e-17
 Identities = 60/154 38%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG  ++ +E  S +SA ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS    +  R D V+   + Y  TVI+GD+L + +E + + + +V    GGS  K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 80.0 bits 359,  Expect = 4e-17
 Identities = 60/154 38%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG  ++ +E  S +SA ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS    +  R D V+   + Y  TVI+GD+L + +E + + + +V    GGS  K ++ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 78.7 bits 352,  Expect = 8e-17
 Identities = 60/154 38%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
            MG  ++ +E  S +SA ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
            EGS    +  R D V+   + Y  TVI+GD+L   +E + + + +V    GGS  K ++ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 57.9 bits 246,  Expect = 1e-10
 Identities = 47/89 52%, Positives = 61/89 68%, Gaps = 17/89 19%
Query  55   KNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGST 114
            K ITFGEGS+Y YVK                 +EGD L D LEK+  E K+V+AP   + 
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  115  LKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +K +SK+H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 46.4 bits 187,  Expect = 1e-07
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGP 51
            GVF +E +  SVI+ ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 40.0 bits 156,  Expect = 4e-05
 Identities = 41/146 28%, Positives = 70/146 47%, Gaps = 13/146 8%
Query  4    FNYEVETPSVISA--ARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
                 Y +E + E D ++ +    VIEG  L   L    + +K+       + + +   +
Sbjct  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLL---RAVETYLLAHSA 157
                DH+ + EE     + ++  L   R +E YL   SA
Sbjct  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.