The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV
EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT
YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA43637 Pha v 1 156 996 243.7 1.7e-66
P25985 Pha v 1 155 989 242.0 5.5e-66
CAA43636 Pha v 1 155 897 220.2 2.1e-59
Q2VU97 Vig r 1.0101 155 867 213.0 2.9e-57
CAA42646 Gly m 4 158 812 200.0 2.6e-53
AAQ91847 Ara h 8.0101 157 729 180.2 2.2e-47
AAD48405 Cor a 1.0401 161 561 140.3 2.4e-35
AAG40331 Cor a 1.0404 161 561 140.3 2.4e-35
AAG40329 Cor a 1.0402 161 553 138.4 8.9e-35
EF436550 Ara h 8.0201 153 550 137.7 1.4e-34
AAG40330 Cor a 1.0403 161 550 137.7 1.5e-34
ACJ23864 Fag s 1.0101 160 548 137.2 2e-34
CAA54696.1 Bet v 1.0301 160 548 137.2 2e-34
APD76154 Jug r 5.0101 160 541 135.5 6.4e-34
O50001 Pru ar 1 160 520 130.6 2e-32
CAD10374 Cas s 1 160 519 130.3 2.4e-32
O24248 Pru av 1 160 516 129.6 3.9e-32
Q2I6V8 Pru p 1.0101 160 515 129.4 4.6e-32
B6CQS9 Pru du 1.0101 160 513 128.9 6.4e-32
CAA96549 Cor a 1.0301 160 503 126.5 3.3e-31
Q256S2 Fra a 1 160 501 126.0 4.6e-31
Q256S7 Fra a 1 160 499 125.6 6.5e-31
AAB01362 Mal d 1.0201 159 498 125.3 7.5e-31
AAD26548 Mal d 1.0204 159 498 125.3 7.5e-31
AAD26545 Mal d 1.0202 159 498 125.3 7.5e-31
Q3T923 Fra a 1 160 497 125.1 9e-31
AAD26555 Mal d 1.0107 159 496 124.9 1e-30
AAD13683 Mal d 1.0206 159 493 124.1 1.7e-30
AAD26547 Mal d 1.0203 159 492 123.9 2e-30
AAK13030 Mal d 1.0207 159 492 123.9 2e-30
ABZ81046 Que a 1.0301 160 492 123.9 2e-30
AAD26558 Mal d 1.0205 159 490 123.4 2.8e-30
AAD26546 Mal d 1.0103 159 490 123.4 2.8e-30
Q256S6 Fra a 1 160 490 123.4 2.8e-30
ABZ81047 Que a 1.0401 160 490 123.4 2.8e-30
AAD29671 Mal d 1.0108 159 488 123.0 3.9e-30
AAD26552 Mal d 1.0104 159 486 122.5 5.4e-30
Q39427 Bet v 1.0205 160 486 122.5 5.5e-30
O65200 Pyr c 1 159 484 122.0 7.6e-30
CAD32318 Mal d 1.0208 158 483 121.8 8.9e-30
CAA58646 Mal d 1.0101 159 483 121.8 8.9e-30
P43186 Bet v 1.0204 160 483 121.8 9e-30
CAA54481 Bet v 1.0202 160 483 121.8 9e-30
AAD26554 Mal d 1.0106 159 482 121.5 1.1e-29
AAD26553 Mal d 1.0105 159 482 121.5 1.1e-29
CAA96535 Mal d 1.0401 160 482 121.5 1.1e-29
P43184 Bet v 1.0203 160 482 121.5 1.1e-29
CAA88833 Mal d 1.0102 159 481 121.3 1.2e-29
CAA54421 Bet v 1.0201 160 481 121.3 1.3e-29
CAA04828.1 Bet v 1.0206 159 480 121.1 1.5e-29
AAO25113 Mal d 1.0304 159 478 120.6 2e-29
Q256S4 Fra a 1 159 478 120.6 2e-29
AAK13029 Mal d 1.0109 159 477 120.3 2.4e-29
AUH28179 Que m 1.0101 160 476 120.1 2.9e-29
CAA96548 Cor a 1.0201 160 476 120.1 2.9e-29
CAA33887 Bet v 1.0101 160 472 119.1 5.5e-29
CAB02159 Bet v 1.0112 160 472 119.1 5.5e-29
CAA54487 Bet v 1.0106 160 472 119.1 5.5e-29
CAA54483 Bet v 1.0103 160 471 118.9 6.5e-29
CAB02161 Bet v 1.0114 160 471 118.9 6.5e-29
CAB02156 Bet v 1.0109 160 471 118.9 6.5e-29
AFN42528 Can s 5.0101 161 470 118.7 7.7e-29
ABZ81045 Que a 1.0201 159 469 118.4 9e-29
CAA54484 Bet v 1.0104 160 469 118.4 9e-29
CAA96536 Mal d 1.0402 160 469 118.4 9e-29
AAK13027 Mal d 1.0302 159 467 118.0 1.2e-28
QOL10866 Que ac 1.0101 159 467 118.0 1.2e-28
NP_001275580 Sola l 4.0201 160 467 118.0 1.3e-28
CAA04827.1 Bet v 1.0116 159 466 117.7 1.5e-28
CAA07329.1 Bet v 1.0118 160 465 117.5 1.7e-28
CAA96537 Mal d 1.0403 160 465 117.5 1.7e-28
AAK13028 Mal d 1.0303 159 464 117.3 2e-28
CAB02160 Bet v 1.0113 160 464 117.2 2.1e-28
CAA96534 Mal d 1.0301 159 460 116.3 3.9e-28
CAB02217 Car b 1.0302 161 460 116.3 4e-28
CAA07323.1 Bet v 1.0117 160 459 116.1 4.7e-28
CAB02155 Bet v 1.0108 160 458 115.8 5.5e-28
AAB24432 Aln g 1 160 457 115.6 6.5e-28
CAB02216 Car b 1.0301 161 456 115.3 7.8e-28
CAA96547 Bet v 1.0115 160 455 115.1 9.1e-28
CAB02207 Car b 1.0104 160 455 115.1 9.1e-28
ABZ81044 Car b 1.0113 160 454 114.9 1.1e-27
ABZ81043 Car b 1.0112 160 454 114.9 1.1e-27
ABZ81041 Car b 1.0110 160 453 114.6 1.3e-27
CAA50325 Cor a 1.0103 160 453 114.6 1.3e-27
CAB02157 Bet v 1.0110 160 453 114.6 1.3e-27
ABZ81040 Car b 1.0109 160 452 114.4 1.5e-27
ACF75030.1 Bet v 1.0207 150 451 114.2 1.6e-27
CAB02209 Car b 1.0106 160 451 114.2 1.8e-27
P38948 Aln g 1 159 450 113.9 2e-27
CAB02213 Car b 1.0107 160 450 113.9 2.1e-27
CAB02158 Bet v 1.0111 160 450 113.9 2.1e-27
CAB02206 Car b 1.0103 160 449 113.7 2.4e-27
ABZ81042 Car b 1.0111 160 449 113.7 2.4e-27
CAM31908 Act c 8.0101 159 448 113.4 2.8e-27
P38950 Car b 1 159 448 113.4 2.8e-27
ADK39021 Ost c 1.0101 160 447 113.2 3.4e-27
QGS84240 Que i 1.0101 159 446 113.0 4e-27
CAB02208 Car b 1.0105 160 446 113.0 4e-27
CAA50327 Cor a 1.0101 160 446 113.0 4e-27
CAA50328 Cor a 1.0102 160 444 112.5 5.6e-27
CAA54482 Bet v 1.0102 160 442 112.0 7.7e-27
CAA54485 Bet v 1.0105 160 441 111.8 9.1e-27
CAB02215 Car b 1.0108 160 440 111.5 1.1e-26
Q08407 Cor a 1 159 439 111.3 1.3e-26
CAA54489 Bet v 1.0107 160 437 110.8 1.8e-26
CAA47357 Car b 1.0102 159 436 110.6 2.1e-26
CAA50326 Cor a 1.0104 160 434 110.1 2.9e-26
AHC08073 Sola l 4.0101 160 432 109.6 4e-26
ABC41615.1 Bet v 1.0119 150 425 108.0 1.2e-25
P38949 Car b 1 159 424 107.7 1.5e-25
CAM31909 Act d 8.0101 157 411 104.7 1.2e-24
Q0Z8U9 Rub i 1.0101 137 378 96.9 2.4e-22
AAL76932 Dau c 1.0201 154 376 96.4 3.9e-22
CAA75803 Lyc e 4.0101 178 377 96.5 4e-22
P92918 Api g 1.0201 159 360 92.5 5.6e-21
P49372 Api g 1 154 346 89.2 5.4e-20
AAB92255 Tar o RAP 157 334 86.4 4e-19
CAA67246 Pet c PR10 155 324 84.0 2e-18
BAA13604 Dau c 1.0102 154 321 83.3 3.3e-18
AAB01092 Dau c 1.0101 168 319 82.8 5.2e-18
CAB06416 Dau c 1.0105 154 315 81.9 8.9e-18
CAB03715 Dau c 1.0103 154 308 80.2 2.8e-17
CAB03716 Dau c 1.0104 154 305 79.5 4.6e-17
Q5ULZ4 Fra a 1.0101 100 211 57.4 1.4e-10
P85126 Que a 1.0101 50 195 53.9 7.4e-10
Q9ZWP8 Vig r 6.0101 155 186 51.2 1.5e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 243.7 bits 996,  Expect = 2e-66
 Identities = 156/156 100%, Positives = 156/156 100%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 2. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 242.0 bits 989,  Expect = 5e-66
 Identities = 155/155 100%, Positives = 155/155 100%, Gaps = 0/155 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
            DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 3. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 220.2 bits 897,  Expect = 2e-59
 Identities = 139/155 89%, Positives = 147/155 94%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            M VFTFEDQTTSPVAPATLYKA+ KDADTI PKA+ DSFKSVEIVEGNGGPGTIKKISFV
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            EDGETKFVLHKIE IDEANLGYSYSIVGG ALP+TAEKI+ DSKLSDGPNGGS++KLSI 
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YHSKGDAPPNEDELKAGKAKSD+LFK +EAYLLANP
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 4. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 213.0 bits 867,  Expect = 3e-57
 Identities = 134/155 86%, Positives = 146/155 94%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            M VFTF+DQ TSPVAPATLY A+AKDAD I PKA+  SF+SVEIVEGNGGPGTIKKISFV
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAV-GSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            EDGETKFVLHKIES+DEANLGYSYSIVGGVALP+TAEKIT D+K+SDG +GGSLIKL+I+
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH KGDAPPNEDELKAGKAKSD+LFKAVEAYLLANP
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 5. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 200.0 bits 812,  Expect = 3e-53
 Identities = 124/155 80%, Positives = 139/155 89%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFTFED+  SPVAPATLYKA+  DAD + PKAL DSFKSVE VEGNGGPGTIKKI+F+
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            EDGETKFVLHKIESIDEANLGYSYS+VGG ALP+TAEKITFDSKL  GPNGGS  KL++ 
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y +KGDA PN+DELK GKAK+D+LFKA+EAYLLA+P
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 6. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 180.2 bits 729,  Expect = 2e-47
 Identities = 110/154 71%, Positives = 133/154 86%, Gaps = 2/154 1%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFTFED+ TS V PA LY A+ KDAD+I PK + D  KSVEIVEGNGGPGTIKK++ V
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKII-DDVKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            EDGETKF+LHK+ESIDEAN  Y+YS+VGGVALP TAEKITF++KL +GPNGGS+ KL++ 
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGDA P+E+ELK GKAK + LF+A+E Y+LANP
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154

Sequence Alignment: 7. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 140.3 bits 561,  Expect = 2e-35
 Identities = 85/156 54%, Positives = 114/156 73%, Gaps = 1/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +ED+ TS + PA L+K+   DAD + PK  P  F S E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSI 119
            E  E K++ HK+E ID AN+ Y YSI+ G  L  T EKI+++ K++  P+GG S++K++ 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
             YH+KG+A  NE+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 8. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 140.3 bits 561,  Expect = 2e-35
 Identities = 85/156 54%, Positives = 114/156 73%, Gaps = 1/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF++ED+ TS + PA L+K+   DAD + PK  P  F S E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSI 119
            E  E K++ HK+E ID AN+ Y YSI+ G  L  T EKI ++ K++  P+GG S++K++ 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
             YH+KG+A  NE+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 9. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 138.4 bits 553,  Expect = 9e-35
 Identities = 83/156 53%, Positives = 114/156 73%, Gaps = 1/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF++ED+ TS + PA L+K+   DAD + PK  P  F   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSI 119
            E  E K++ HK+E ID AN+ Y YSI+ G  L  T EKI+++ K++  P+GG S++K++ 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
             YH+KG+A  +E+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 10. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 137.7 bits 550,  Expect = 1e-34
 Identities = 82/153 53%, Positives = 116/153 75%, Gaps = 2/153 1%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV TFE+++TSPV PA L+KA   D D + PK +P + +S+EIVEGNGGPGT+KK++ V
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            EDG+T +VLHKI++IDEA   Y Y+I GG  + E  EK++F +KL +  +GGS IK+S+T
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKL-EAADGGSKIKVSVT 118
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDAP  ++  +  K KS  +FKA+E Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 11. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 137.7 bits 550,  Expect = 1e-34
 Identities = 83/156 53%, Positives = 113/156 72%, Gaps = 1/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +ED+ TS + PA L+K+   DAD + PK  P  F   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSI 119
            E  E K++ HK+E ID AN+ Y YSI+ G  L  T EKI+++ K++  P+GG S++K++ 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
             YH+KG+A  +E+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 12. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 137.2 bits 548,  Expect = 2e-34
 Identities = 81/156 51%, Positives = 113/156 72%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E +TT+ + PA L+KA   DAD + PK  P + KS EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+ ID AN+ Y+ +++ G A+ ET EKI ++ KL   P+GGS++K +  
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    ED++KAGK ++  +FKAVEAYLLANP
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156

Sequence Alignment: 13. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 137.2 bits 548,  Expect = 2e-34
 Identities = 80/156 51%, Positives = 111/156 71%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +ED+ TS +APA L+K+   DAD + PK  P++  S E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K++ H+++ ID AN+ Y YSI+ G  L +T EKI+++ K+   P GGS++K++  
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD   NE+E+KAGK K   LFKAVE YL+A+P
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHP 156

Sequence Alignment: 14. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 135.5 bits 541,  Expect = 6e-34
 Identities = 81/156 51%, Positives = 113/156 72%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E ++TS + PA L+KA   DAD + PK +P + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  + K+V H+ ++IDEAN+ Y+YS++ G AL +  EKI++++K+     GGS++K    
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YHSKGD    E+++K GK K+  LFKAVE YLLA+P
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156

Sequence Alignment: 15. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 130.6 bits 520,  Expect = 2e-32
 Identities = 77/156 49%, Positives = 107/156 68%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GG GTIKK++F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+++ ID+ NL YSY+++ G AL +  E I +D KL   P+GGS++K +  
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+++KAGK K+  LFK VEAYLLANP
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156

Sequence Alignment: 16. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 130.3 bits 519,  Expect = 2e-32
 Identities = 78/155 50%, Positives = 110/155 70%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT E++ TS + P  L+KA   DAD + PK  P + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  + K+V H+I+ ID+AN+ Y YS++ G  + E  EKI+++ K+   P+GGS++K +  
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+    E+++ AGK K+  LFKAVEAYLLA+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 17. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 129.6 bits 516,  Expect = 4e-32
 Identities = 77/156 49%, Positives = 109/156 69%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+SID+ N  YSY+++ G AL +T EKI++++KL   P+GGS+IK +  
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGK K+ +LFK +E YL  +P
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156

Sequence Alignment: 18. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 129.4 bits 515,  Expect = 5e-32
 Identities = 77/156 49%, Positives = 108/156 69%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+SID+ N  YSY+++ G AL +  EKI++++KL   P+GGS+IK +  
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+ +LFK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156

Sequence Alignment: 19. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 128.9 bits 513,  Expect = 6e-32
 Identities = 78/156 50%, Positives = 110/156 70%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG+FT+ D++TS + P  L+KA+  +ADT+ PK  P S KS EIVEG+GG GTIKKISF 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V H+I+ +D+ N+ Y+YS+V G AL +  EKI+++ KL    +GGS+IK +  
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+++KAGK K+  LFK +E YL+ANP
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANP 156

Sequence Alignment: 20. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 126.5 bits 503,  Expect = 3e-31
 Identities = 75/155 48%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS + PA L+K    D+D + PK  P + KS+EI+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     ++ +K+E ID+AN+ Y YS++ G AL +  EKI ++ K+   P+GGS++K    
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+ GD    ++++KAGK K+  LFKAVE YLLA+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 126.0 bits 501,  Expect = 5e-31
 Identities = 76/156 48%, Positives = 104/156 66%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V HKI SID+ N  YSYS++ G AL E  EKI +++KL   P+GG++IK +  
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHP 156

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 125.6 bits 499,  Expect = 6e-31
 Identities = 75/156 48%, Positives = 104/156 66%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 23. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 125.3 bits 498,  Expect = 8e-31
 Identities = 75/155 48%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 24. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 125.3 bits 498,  Expect = 8e-31
 Identities = 75/155 48%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLM-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 25. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 125.3 bits 498,  Expect = 8e-31
 Identities = 75/155 48%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 125.1 bits 497,  Expect = 9e-31
 Identities = 75/156 48%, Positives = 104/156 66%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 27. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 124.9 bits 496,  Expect = 1e-30
 Identities = 77/155 49%, Positives = 108/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGKAK+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHP 155

Sequence Alignment: 28. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 124.1 bits 493,  Expect = 2e-30
 Identities = 74/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+K    DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 29. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 123.9 bits 492,  Expect = 2e-30
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E++L  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHP 155

Sequence Alignment: 30. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 123.9 bits 492,  Expect = 2e-30
 Identities = 74/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGT KKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 31. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 123.9 bits 492,  Expect = 2e-30
 Identities = 71/156 45%, Positives = 108/156 69%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E +  S + PA L+KA   D+D + PK +P ++KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K   H+I+ ID  N+ YS+S++ G AL +  E ++ ++K+   P+GGS++K +  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156

Sequence Alignment: 32. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 123.4 bits 490,  Expect = 3e-30
 Identities = 74/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ + AGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 33. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 123.4 bits 490,  Expect = 3e-30
 Identities = 76/155 49%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 123.4 bits 490,  Expect = 3e-30
 Identities = 74/156 47%, Positives = 103/156 66%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG +T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 35. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 123.4 bits 490,  Expect = 3e-30
 Identities = 74/156 47%, Positives = 107/156 68%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K   H+I+ ID  N+ YS+S++ G AL +  E ++ ++K+   P+GGS+ K +  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHP 156

Sequence Alignment: 36. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 123.0 bits 488,  Expect = 4e-30
 Identities = 76/155 49%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 37. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 122.5 bits 486,  Expect = 5e-30
 Identities = 76/155 49%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 38. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 122.5 bits 486,  Expect = 5e-30
 Identities = 75/155 48%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D AN+ YSYS++ G AL +T EKI  + KL   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +KA K K+++L++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 39. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 122.0 bits 484,  Expect = 8e-30
 Identities = 74/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG++TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+++SIDEA+  Y+Y+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLV-ASGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 40. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 121.8 bits 483,  Expect = 9e-30
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GV+T+E++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 119
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHP 154

Sequence Alignment: 41. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 121.8 bits 483,  Expect = 9e-30
 Identities = 75/155 48%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +K GK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 42. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 121.8 bits 483,  Expect = 9e-30
 Identities = 74/155 47%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 43. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 121.8 bits 483,  Expect = 9e-30
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 44. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 121.5 bits 482,  Expect = 1e-29
 Identities = 75/155 48%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T E I++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 45. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 121.5 bits 482,  Expect = 1e-29
 Identities = 76/155 49%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 46. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 121.5 bits 482,  Expect = 1e-29
 Identities = 73/155 47%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +    L+KA   D D + PK  P + KS EI+EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 47. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 121.5 bits 482,  Expect = 1e-29
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 48. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 121.3 bits 481,  Expect = 1e-29
 Identities = 73/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSIS-H 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH KG+    E+ +K GK K   LFK +E+YL  +P
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHP 155

Sequence Alignment: 49. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 121.3 bits 481,  Expect = 1e-29
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 50. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 121.1 bits 480,  Expect = 1e-29
 Identities = 74/154 48%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + KL   P+GGS++K+S  Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 51. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 120.6 bits 478,  Expect = 2e-29
 Identities = 74/155 47%, Positives = 104/155 67%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E YLL +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155

Sequence Alignment: 52. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 120.6 bits 478,  Expect = 2e-29
 Identities = 74/155 47%, Positives = 103/155 66%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+G ++IK +  
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155

Sequence Alignment: 53. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 120.3 bits 477,  Expect = 2e-29
 Identities = 75/155 48%, Positives = 105/155 67%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KG+    E+ +K GK K+  LFK +E+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 54. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 120.1 bits 476,  Expect = 3e-29
 Identities = 68/156 43%, Positives = 106/156 67%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV  +E +  S + PA L+KA   D+D + PK +P ++KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K   H+I+ ID  N+ +S+S++ G AL +  E ++ ++K+   P+GGS++K +  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHP 156

Sequence Alignment: 55. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 120.1 bits 476,  Expect = 3e-29
 Identities = 71/155 45%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E ++TS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD   + + +K GK K + LF+AVEAYLLA+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 56. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 119.1 bits 472,  Expect = 6e-29
 Identities = 71/155 45%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 57. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 119.1 bits 472,  Expect = 6e-29
 Identities = 71/155 45%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 58. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 119.1 bits 472,  Expect = 6e-29
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 59. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 118.9 bits 471,  Expect = 7e-29
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 60. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 118.9 bits 471,  Expect = 7e-29
 Identities = 71/155 45%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 61. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 118.9 bits 471,  Expect = 7e-29
 Identities = 71/155 45%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 62. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 118.7 bits 470,  Expect = 8e-29
 Identities = 78/156 50%, Positives = 107/156 68%, Gaps = 1/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS +APA L+KA   D D + PK  P + + VEI+EGNGG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALP-ETAEKITFDSKLSDGPNGGSLIKLSI 119
            +    K+V HKIE+ID+ +L YSYSI+ G AL     EKIT +SKL    +GG++IK   
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
             Y+S GDA  NE+++K G+ ++  ++K VEAYL  +P
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHP 157

Sequence Alignment: 63. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 118.4 bits 469,  Expect = 9e-29
 Identities = 73/155 47%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  + K+  H+I+++D  N  YS+S++ G AL    E ++ + K    P+GGS++K +  
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y++KGD    E++++A   K+  L+KAVEAYL+A+P
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155

Sequence Alignment: 64. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 118.4 bits 469,  Expect = 9e-29
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 65. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 118.4 bits 469,  Expect = 9e-29
 Identities = 71/155 45%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS +    L+KA   D D + PK  P + KS +I+EG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 66. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 118.0 bits 467,  Expect = 1e-28
 Identities = 73/152 48%, Positives = 102/152 67%, Gaps = 1/152 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLL 153
            YH+KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 67. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 118.0 bits 467,  Expect = 1e-28
 Identities = 71/155 45%, Positives = 104/155 67%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV+ +E Q TS + PA L+KA   D+D +  K LP + KS EI+EGNGGPGTIKK +F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  + K+  H+I+++D  N  YS+S++ G AL + A  I+ + K+   P+GGS++K +  
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y++KG     E++++A   K   LFKAVEAYLLA+P
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155

Sequence Alignment: 68. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 118.0 bits 467,  Expect = 1e-28
 Identities = 72/156 46%, Positives = 102/156 65%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV TF  ++T+ +AP  L+K +  D D++ PK L    KS+EIVEG+GG G+IK+++FV
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E G  K++ HKI  ID+ NL   YS++ G  L +  E I +D K+    +GG + K +  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD   +E+E   GK K+  LFKA+EAYLLANP
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156

Sequence Alignment: 69. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 117.7 bits 466,  Expect = 1e-28
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                K+V  +++ +D AN+ YSYS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 70. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 117.5 bits 465,  Expect = 2e-28
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + KL   P+GGS++++S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 71. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 117.5 bits 465,  Expect = 2e-28
 Identities = 71/155 45%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS +    L+KA   D D + PK  P + KS EI+EG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            Y +KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 72. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 117.3 bits 464,  Expect = 2e-28
 Identities = 75/152 49%, Positives = 101/152 66%, Gaps = 1/152 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVFT+E + TS + PA LY A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V HKI+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK    
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSISH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLL 153
            YH+KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 73. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 117.2 bits 464,  Expect = 2e-28
 Identities = 70/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 74. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 116.3 bits 460,  Expect = 4e-28
 Identities = 72/154 46%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E     +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+K D    E+ +KAGK K+  LFK +E YLLA+
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 75. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 116.3 bits 460,  Expect = 4e-28
 Identities = 69/155 44%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K++  
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +K GK + + L+K VEAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 76. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 116.1 bits 459,  Expect = 5e-28
 Identities = 69/155 44%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 77. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 115.8 bits 458,  Expect = 6e-28
 Identities = 69/155 44%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 78. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 115.6 bits 457,  Expect = 7e-28
 Identities = 68/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+KA   D D ++PK  P++  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YS+S++ G A+ +  EK+  + K+   P+GGS++K+S  
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +++K  K K+  L+KAVE+YLLA+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 79. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 115.3 bits 456,  Expect = 8e-28
 Identities = 69/155 44%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K++  
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     + +K GK + + L+K VEAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 80. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 115.1 bits 455,  Expect = 9e-28
 Identities = 70/155 45%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +   N+ YSYS++ G  + +T EKI+ + K+   P+G S++K+S  
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 81. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 115.1 bits 455,  Expect = 9e-28
 Identities = 66/155 42%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 82. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 114.9 bits 454,  Expect = 1e-27
 Identities = 67/155 43%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ YSY+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 83. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 114.9 bits 454,  Expect = 1e-27
 Identities = 66/155 42%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 84. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 114.6 bits 453,  Expect = 1e-27
 Identities = 66/155 42%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 85. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 114.6 bits 453,  Expect = 1e-27
 Identities = 67/155 43%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 86. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 114.6 bits 453,  Expect = 1e-27
 Identities = 68/155 43%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +  EKI+ + K+   P+GG ++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 87. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 114.4 bits 452,  Expect = 1e-27
 Identities = 66/155 42%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 88. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 114.2 bits 451,  Expect = 2e-27
 Identities = 69/150 46%, Positives = 101/150 67%, Gaps = 0/150 0%
Query  4    FTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDG 63
            F +E +TTS +  A L+KA   + D + PK  P +  SVE +EGNGGPGTIKKI+F E  
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   ETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHS 123
              K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  YH+
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDAPPNEDELKAGKAKSDSLFKAVEAYLL 153
            KGD     + +KA K K ++L++AVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 89. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 114.2 bits 451,  Expect = 2e-27
 Identities = 66/155 42%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 90. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 113.9 bits 450,  Expect = 2e-27
 Identities = 67/154 43%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E +T S +  A L+KA   D D ++PK  P++  SVE +EGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                K+V  +++ +D  N+ YS+S++ G A+ +  EK+  + K+   P+GGS++K+S  +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KGD   N +++K  K K+  L+KAVE+YLLA+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 91. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 113.9 bits 450,  Expect = 2e-27
 Identities = 66/155 42%, Positives = 102/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ +SY+++ G  L +  EK++++ K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 92. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 113.9 bits 450,  Expect = 2e-27
 Identities = 68/155 43%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
                 K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 93. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 113.7 bits 449,  Expect = 2e-27
 Identities = 65/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 94. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 113.7 bits 449,  Expect = 2e-27
 Identities = 65/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 95. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 113.4 bits 448,  Expect = 3e-27
 Identities = 72/156 46%, Positives = 103/156 66%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV T++ +  S V P  LYKA   D DT+ PK LP + K V+I+EG+G  GTIK+++F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K V +++++ID+ NL YSY+I+ G  L E  E I++  K+   P+GGS+ K    
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y +KGD   +E+E+K GK K+  +FKA+EAYLLANP
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 96. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 113.4 bits 448,  Expect = 3e-27
 Identities = 67/154 43%, Positives = 101/154 65%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                K+V  ++E ID  N+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KG    N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 97. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 113.2 bits 447,  Expect = 3e-27
 Identities = 65/155 41%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +   VE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 98. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 113.0 bits 446,  Expect = 4e-27
 Identities = 71/155 45%, Positives = 103/155 66%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV T E Q TS + PA L+KA   D+D + PK LP + KS+E +EGNGGPGTIKKI+F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E  + K+  H+I+++D  N  YS+S++ G AL +    ++ + K+   P+GGS+ K +  
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y++KGD    E++++A   K   L KAVEAYLLA+P
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155

Sequence Alignment: 99. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 113.0 bits 446,  Expect = 4e-27
 Identities = 65/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 100. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 113.0 bits 446,  Expect = 4e-27
 Identities = 66/155 42%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 101. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 112.5 bits 444,  Expect = 6e-27
 Identities = 66/155 42%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 102. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 112.0 bits 442,  Expect = 8e-27
 Identities = 67/155 43%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 103. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 111.8 bits 441,  Expect = 9e-27
 Identities = 66/155 42%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +TTS +  A L+KA   + D + PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 104. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 111.5 bits 440,  Expect = 1e-26
 Identities = 65/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    KFV  +++ +D AN+ +SY+++ G  L +  EK++++  +   P GGS++K+S  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 105. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 111.3 bits 439,  Expect = 1e-26
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 106. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 110.8 bits 437,  Expect = 2e-26
 Identities = 65/155 41%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E + TS +  A ++KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 107. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 110.6 bits 436,  Expect = 2e-26
 Identities = 64/154 41%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KG    N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 108. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 110.1 bits 434,  Expect = 3e-26
 Identities = 65/155 41%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGVF +E +T S ++ A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS +K+S  
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 109. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 109.6 bits 432,  Expect = 4e-26
 Identities = 68/156 43%, Positives = 100/156 64%, Gaps = 0/156 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV T+  ++T+ ++P  L+KA+  D D + PK L    K+ E +EG+GG G+IK+++FV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E G  K++ HKI  ID+ NL   YS++ G  L E  E IT+D K+    NGG + K +  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            YH+KGD   +E+E   G+ +  ++ KAVEAYLLANP
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156

Sequence Alignment: 110. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 108.0 bits 425,  Expect = 1e-25
 Identities = 63/150 42%, Positives = 100/150 66%, Gaps = 0/150 0%
Query  4    FTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDG 63
            F +E +TTS +  A L+KA   D D +FPK  P +  SV+ +EGNGGPGTIKKI+F E  
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   ETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHS 123
              K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  YH+
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDAPPNEDELKAGKAKSDSLFKAVEAYLL 153
            KG+     +++KA K   ++L++AVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 111. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 107.7 bits 424,  Expect = 1e-25
 Identities = 63/154 40%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
            GVF +E +T S +  A L+K+   D D + PK  P    SVE V GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            H+KG    N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 112. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 104.7 bits 411,  Expect = 1e-24
 Identities = 68/155 43%, Positives = 98/155 63%, Gaps = 1/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG  T++ +  S ++   ++KA   D DTI PKALP +   V+ +EG+GG GTIK  +F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E    K V H+I+ +D+ N+ YSYSI+ G AL +  E I++  K+   P+GG + K    
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            Y  K DA  +E+E+KAGK ++  +FK VEAYLLANP
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 96.9 bits 378,  Expect = 2e-22
 Identities = 63/135 46%, Positives = 87/135 64%, Gaps = 1/135 0%
Query  11   TSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFVLH 70
            TS + P  L+KA   DAD + PK  P + KSVEI+EG+GG GT+KKI + E  E  +V H
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   KIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAPPN 130
            KI+ +D+ N+ YSYSI  G AL +  EKI+++ KL      GS+IK +  YH KG A   
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLV-ASGRGSIIKTTSHYHCKGGAEIK 120
Query  131  EDELKAGKAKSDSLFK 146
            E+++K GK ++  LFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 114. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 96.4 bits 376,  Expect = 4e-22
 Identities = 66/153 43%, Positives = 97/153 63%, Gaps = 3/153 1%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV   E +  S V+   +Y+    D DT+FPK LP   KSVEI+EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGP-NGGSLIKLSI 119
            E  E   + +K++ ID+A LGY+Y+ +GG  L E  E +   +++   P +GG ++K + 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV--NQFVVVPTDGGCIVKNTT 118
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
             Y++KGDA   ED++K    KS   FKAVEAYLLAN
Sbjct  119  IYNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 96.5 bits 377,  Expect = 4e-22
 Identities = 58/146 39%, Positives = 90/146 61%, Gaps = 0/146 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV T+  ++T+ ++P  L+KA+  D D + PK L    K+ E +EG+GG G+IK+++FV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E G  K++ HKI  ID+ NL   YS++ G  L E  E IT+D K+    NGG + K +  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFK 146
            YH+KGD   +E+E   G+ ++   F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 92.5 bits 360,  Expect = 6e-21
 Identities = 64/153 41%, Positives = 95/153 62%, Gaps = 3/153 1%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV     +  S V+   +Y+    D DT+FPK LP   KSVEI+EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGP-NGGSLIKLSI 119
            E  E   + +K++ ID+A L Y+Y+ +GG  L +  E +   +++   P +GG ++K + 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVV--NEFVVVPTDGGCIVKNTT 118
Query  120  TYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
             Y++KGDA   ED++K    KS   FKAVEAYLLAN
Sbjct  119  IYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 89.2 bits 346,  Expect = 5e-20
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV T   + TS V+   +++    D DT++PKA P ++KSVEI +G+GGPGT+K I++ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            + G    +  +I+ +++  L + YS++ G  L    E I     L    +GGS+ K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDA   E+ +K    ++ +LFKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 86.4 bits 334,  Expect = 4e-19
 Identities = 57/154 37%, Positives = 90/154 58%, Gaps = 2/154 1%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            M V  FE   TS ++P+ ++KA   D DTI PKA P+++KS++ +EG+GG GTIK I++ 
Sbjct  1    MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            +        HK+++ID  N+  SY+I  G  L    E  T   K+    +GGS+ K S+ 
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            +  KGDA   ++ +   K      FKA+E Y++++P
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 119. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 84.0 bits 324,  Expect = 2e-18
 Identities = 58/155 37%, Positives = 92/155 59%, Gaps = 0/155 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MGV   E   TS V  A L+KA+  D DT++P+ LP + K  EI+EG+GG GT+K +++ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            +    K + +KI++ID+  + +SYSI+ G  L    + I     +    +GG     +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +++KGDA   E+ +K    +++ +FKAVEAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 83.3 bits 321,  Expect = 3e-18
 Identities = 52/154 33%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG  +   + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E      +  + +++++  L Y  +++ G  L E  E I     +    +GGS+ K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDA   E+ +K   A++ +LFKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 82.8 bits 319,  Expect = 5e-18
 Identities = 52/154 33%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG  +   + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E      +  + +++++  L Y  +++ G  L E  E I     +    +GGS+ K +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDA   E+ +K   A++ +LFKA+EAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 81.9 bits 315,  Expect = 9e-18
 Identities = 52/154 33%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG  +   + TS V+   ++  +  D DT+ PKA P ++KSVE V+G+GG GT++ I++ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E      +  + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDA   E+ +K   A++ +LFKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 80.2 bits 308,  Expect = 3e-17
 Identities = 51/154 33%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG  +   + TS V+   ++  +  D DT+ PKA   ++KSVE V+G+GG GT++ I++ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E      +  + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDA   E+ +K   A++ +LFKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 79.5 bits 305,  Expect = 5e-17
 Identities = 50/154 32%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
            MG  +   + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
            E      +  + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155
            +H+KGDA   E+ +K    ++ +LFKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 57.4 bits 211,  Expect = 1e-10
 Identities = 39/96 40%, Positives = 59/96 61%, Gaps = 3/96 3%
Query  58   SFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKL 117
            +FV D +  ++  KI +  E +  Y Y  V G AL +T EKI +++KL   P+  ++IK 
Sbjct  1    AFVLDADN-LIPKKI-TFGEGSQ-YGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKT 57
Query  118  SITYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156
            +  YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  58   TSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHP 96

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 53.9 bits 195,  Expect = 7e-10
 Identities = 29/50 58%, Positives = 36/50 72%, Gaps = 0/50 0%
Query  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGP 51
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 51.2 bits 186,  Expect = 2e-08
 Identities = 43/142 30%, Positives = 74/142 52%, Gaps = 9/142 6%
Query  6    FEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGET 65
            F  QT   V    L+  ++KD  T+ PK LP   K V+++EG+GG GTI   +F+ +   
Sbjct  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
Query  66   KFVLHKIESIDEANLGYSYSIVGGVALPE--TAEKITFDSKLSDGPNGGSLIKLSITYHS 123
             +   +I   DE++      ++ G  L +  +  K TF  KLS+     +L+ + I+Y  
Sbjct  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTF--KLSEIEEDKTLVNVKISYDH 122
Query  124  KGDAPPNEDELKAGKAKSDSL--FKAVEAYL 152
              D    E+++   K    +L  ++ +E YL
Sbjct  123  DSDI---EEKVTPTKTSQSTLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.