The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG
EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY
QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK
Sequence Info Allergen Name Length Opt Bits Score E Value
ABZ81045 Que a 1.0201 159 1008 272.1 5e-75
QGS84240 Que i 1.0101 159 875 237.1 1.7e-64
QOL10866 Que ac 1.0101 159 858 232.7 3.8e-63
ABZ81047 Que a 1.0401 160 839 227.6 1.2e-61
ABZ81046 Que a 1.0301 160 774 210.5 1.7e-56
AUH28179 Que m 1.0101 160 749 204.0 1.6e-54
CAD10374 Cas s 1 160 697 190.3 2.2e-50
ACJ23864 Fag s 1.0101 160 692 189.0 5.4e-50
APD76154 Jug r 5.0101 160 683 186.6 2.8e-49
O50001 Pru ar 1 160 670 183.2 3e-48
Q2I6V8 Pru p 1.0101 160 648 177.4 1.6e-46
O24248 Pru av 1 160 645 176.6 2.8e-46
CAA96549 Cor a 1.0301 160 641 175.6 5.9e-46
CAA54696.1 Bet v 1.0301 160 641 175.6 5.9e-46
CAA96535 Mal d 1.0401 160 630 172.7 4.3e-45
CAA96537 Mal d 1.0403 160 628 172.1 6.3e-45
B6CQS9 Pru du 1.0101 160 627 171.9 7.5e-45
Q39427 Bet v 1.0205 160 619 169.8 3.2e-44
CAA96536 Mal d 1.0402 160 618 169.5 3.9e-44
P43186 Bet v 1.0204 160 617 169.3 4.7e-44
AAO25113 Mal d 1.0304 159 614 168.5 8e-44
CAA04828.1 Bet v 1.0206 159 608 166.9 2.4e-43
AAG40329 Cor a 1.0402 161 605 166.1 4.2e-43
P43184 Bet v 1.0203 160 604 165.8 5e-43
AAB01362 Mal d 1.0201 159 603 165.6 5.9e-43
AAD26545 Mal d 1.0202 159 603 165.6 5.9e-43
AAG40330 Cor a 1.0403 161 602 165.3 7.2e-43
AAD48405 Cor a 1.0401 161 602 165.3 7.2e-43
AAD26558 Mal d 1.0205 159 601 165.0 8.5e-43
AAB24432 Aln g 1 160 601 165.0 8.6e-43
CAA54421 Bet v 1.0201 160 601 165.0 8.6e-43
CAA54481 Bet v 1.0202 160 601 165.0 8.6e-43
AAD26548 Mal d 1.0204 159 599 164.5 1.2e-42
AAG40331 Cor a 1.0404 161 599 164.5 1.3e-42
AAD13683 Mal d 1.0206 159 598 164.3 1.5e-42
AAK13030 Mal d 1.0207 159 597 164.0 1.8e-42
AAD26547 Mal d 1.0203 159 597 164.0 1.8e-42
CAB02160 Bet v 1.0113 160 597 164.0 1.8e-42
AFN42528 Can s 5.0101 161 596 163.7 2.2e-42
AAK13027 Mal d 1.0302 159 595 163.5 2.5e-42
AAD26546 Mal d 1.0103 159 595 163.5 2.5e-42
AAD26554 Mal d 1.0106 159 594 163.2 3.1e-42
P38948 Aln g 1 159 594 163.2 3.1e-42
CAA07329.1 Bet v 1.0118 160 594 163.2 3.1e-42
CAA96534 Mal d 1.0301 159 593 162.9 3.7e-42
O65200 Pyr c 1 159 593 162.9 3.7e-42
AAD29671 Mal d 1.0108 159 593 162.9 3.7e-42
Q256S7 Fra a 1 160 593 162.9 3.7e-42
AAD26552 Mal d 1.0104 159 592 162.7 4.4e-42
CAB02159 Bet v 1.0112 160 592 162.7 4.4e-42
CAA33887 Bet v 1.0101 160 592 162.7 4.4e-42
CAB02156 Bet v 1.0109 160 591 162.4 5.3e-42
Q3T923 Fra a 1 160 591 162.4 5.3e-42
CAB02161 Bet v 1.0114 160 590 162.1 6.4e-42
CAD32318 Mal d 1.0208 158 589 161.9 7.5e-42
AAD26555 Mal d 1.0107 159 589 161.9 7.6e-42
CAA58646 Mal d 1.0101 159 588 161.6 9.1e-42
CAA54487 Bet v 1.0106 160 588 161.6 9.2e-42
AAD26553 Mal d 1.0105 159 587 161.4 1.1e-41
Q256S2 Fra a 1 160 587 161.4 1.1e-41
CAA54483 Bet v 1.0103 160 587 161.4 1.1e-41
CAA96548 Cor a 1.0201 160 585 160.8 1.6e-41
CAA04827.1 Bet v 1.0116 159 584 160.6 1.9e-41
Q256S6 Fra a 1 160 584 160.6 1.9e-41
CAB02157 Bet v 1.0110 160 583 160.3 2.3e-41
CAA54484 Bet v 1.0104 160 583 160.3 2.3e-41
AAK13029 Mal d 1.0109 159 582 160.0 2.7e-41
AAK13028 Mal d 1.0303 159 581 159.8 3.3e-41
CAA88833 Mal d 1.0102 159 579 159.3 4.7e-41
CAA07323.1 Bet v 1.0117 160 579 159.3 4.8e-41
CAB02155 Bet v 1.0108 160 578 159.0 5.7e-41
CAA96547 Bet v 1.0115 160 578 159.0 5.7e-41
CAA54485 Bet v 1.0105 160 578 159.0 5.7e-41
CAA54482 Bet v 1.0102 160 575 158.2 9.9e-41
Q256S4 Fra a 1 159 572 157.4 1.7e-40
CAA54489 Bet v 1.0107 160 571 157.2 2e-40
CAB02158 Bet v 1.0111 160 570 156.9 2.5e-40
CAA50325 Cor a 1.0103 160 569 156.6 2.9e-40
CAB02217 Car b 1.0302 161 567 156.1 4.3e-40
ACF75030.1 Bet v 1.0207 150 563 155.1 8e-40
CAA50327 Cor a 1.0101 160 557 153.5 2.6e-39
CAB02216 Car b 1.0301 161 557 153.5 2.6e-39
CAA50328 Cor a 1.0102 160 555 152.9 3.8e-39
Q08407 Cor a 1 159 550 151.6 9.3e-39
CAB02207 Car b 1.0104 160 544 150.0 2.8e-38
CAB02206 Car b 1.0103 160 544 150.0 2.8e-38
CAA50326 Cor a 1.0104 160 542 149.5 4e-38
CAB02208 Car b 1.0105 160 541 149.3 4.9e-38
ABZ81040 Car b 1.0109 160 536 147.9 1.2e-37
ABZ81042 Car b 1.0111 160 534 147.4 1.7e-37
ABZ81043 Car b 1.0112 160 534 147.4 1.7e-37
CAM31908 Act c 8.0101 159 533 147.2 2.1e-37
ABZ81041 Car b 1.0110 160 533 147.2 2.1e-37
ADK39021 Ost c 1.0101 160 531 146.6 3e-37
CAB02209 Car b 1.0106 160 531 146.6 3e-37
ABZ81044 Car b 1.0113 160 530 146.4 3.6e-37
CAB02213 Car b 1.0107 160 530 146.4 3.6e-37
P38950 Car b 1 159 526 145.3 7.4e-37
ABC41615.1 Bet v 1.0119 150 525 145.1 8.1e-37
CAM31909 Act d 8.0101 157 525 145.1 8.7e-37
CAB02215 Car b 1.0108 160 520 143.7 2.2e-36
CAA47357 Car b 1.0102 159 516 142.7 4.6e-36
P38949 Car b 1 159 503 139.3 4.9e-35
CAA42646 Gly m 4 158 486 134.8 1.1e-33
Q0Z8U9 Rub i 1.0101 137 478 132.8 3.7e-33
NP_001275580 Sola l 4.0201 160 477 132.4 5.7e-33
CAA43637 Pha v 1 156 469 130.3 2.3e-32
AHC08073 Sola l 4.0101 160 466 129.5 4.2e-32
P25985 Pha v 1 155 462 128.5 8.3e-32
CAA43636 Pha v 1 155 451 125.6 6.2e-31
AAQ91847 Ara h 8.0101 157 443 123.5 2.7e-30
Q2VU97 Vig r 1.0101 155 432 120.6 2e-29
CAA67246 Pet c PR10 155 429 119.8 3.4e-29
EF436550 Ara h 8.0201 153 412 115.4 7.4e-28
P92918 Api g 1.0201 159 411 115.1 9.5e-28
AAL76932 Dau c 1.0201 154 402 112.7 4.6e-27
CAA75803 Lyc e 4.0101 178 402 112.6 5.8e-27
AAB92255 Tar o RAP 157 390 109.6 4.3e-26
P49372 Api g 1 154 378 106.4 3.7e-25
CAB03716 Dau c 1.0104 154 366 103.3 3.3e-24
CAB06416 Dau c 1.0105 154 363 102.5 5.7e-24
BAA13604 Dau c 1.0102 154 359 101.4 1.2e-23
AAB01092 Dau c 1.0101 168 357 100.8 1.9e-23
CAB03715 Dau c 1.0103 154 349 98.8 7.3e-23
P85126 Que a 1.0101 50 316 91.0 5.4e-21
Q5ULZ4 Fra a 1.0101 100 243 71.2 9.4e-15
Q9S8Q4 Cas s 1 24 130 42.6 9.5e-07
Q9ZWP8 Vig r 6.0101 155 143 44.6 1.5e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 272.1 bits 1008,  Expect = 5e-75
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
            EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK 159
            QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK
Sbjct  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK 159

Sequence Alignment: 2. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 237.1 bits 875,  Expect = 2e-64
 Identities = 141/158 89%, Positives = 144/158 91%, Gaps = 0/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV THESQETSVI PARLFKA+ LDSDNLI KVLPQAIKS E IEGNGGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
            EASKFKY+KHRIDALDPENCTYSFSVIEGDALT M SVSTEIK VASPDGGSI KSTTKY
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            QTKGDFQLKEEQIQA IEK  GL KAVEAYL+AHPDLY
Sbjct  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 3. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 232.7 bits 858,  Expect = 4e-63
 Identities = 132/158 83%, Positives = 145/158 91%, Gaps = 0/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+ +ESQETSVI PARLFKA+ LDSDNLI KVLP+A+KSTEIIEGNGGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
            EASK KYAKHRID LDPENC+YSFSVIEG+ALT + S+STE+K VASPDGGSIMKSTTKY
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            QTKG FQLKEEQIQAA+EK  GL+KAVEAYL+AHPDLY
Sbjct  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158

Sequence Alignment: 4. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 227.6 bits 839,  Expect = 1e-61
 Identities = 134/159 84%, Positives = 145/159 91%, Gaps = 1/159 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S +K+AKHRID +DPEN TYSFSVIEGDAL   +E+VSTE K VASPDGGSI KST+K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK 159
            YQTKGDFQL +E I+   EKA+G++KAVEAYLVAHPDLYK
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLYK 160

Sequence Alignment: 5. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 210.5 bits 774,  Expect = 2e-56
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S +K+AKHRID +DPEN TYSFSVIEGDAL   +E+VSTE K VASPDGGSI+KST+K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK 159
            YQTKGDFQL +E I+   EKA+ ++KAVEAYLVAHPDLYK
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK 160

Sequence Alignment: 6. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 204.0 bits 749,  Expect = 2e-54
 Identities = 119/158 75%, Positives = 137/158 86%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV  +ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S +K+AKHRID +DPEN T+SFSVIEGDAL   +E+VSTE K VASPDGGSI+KST K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            YQTKGDFQL +E I+   EKA+G++KAVEAYLVAHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 7. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 190.3 bits 697,  Expect = 2e-50
 Identities = 108/158 68%, Positives = 132/158 83%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFTHE++ TS I P RLFKA+ LD+DNLI K+ P+AIKS EIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S+FKY KHRID +D  N TY +SVIEGD +  ++E +S EIK VASPDGGSI+K+T+K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE++ A  EKAAGL+KAVEAYL+AH D Y
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY 159

Sequence Alignment: 8. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 189.0 bits 692,  Expect = 5e-50
 Identities = 106/158 67%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES+ T+VI PARLFKA+ LD+DNLI KV PQAIKS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S+F Y KHRID +D  N TY+ ++IEGDA++  +E ++ EIK VASPDGGSI+KST+K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KE+QI+A  E+A+G++KAVEAYL+A+P  Y
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159

Sequence Alignment: 9. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 186.6 bits 683,  Expect = 3e-49
 Identities = 104/158 65%, Positives = 131/158 82%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E++ TSVI PARLFKA+ LD+DNLI KV+PQA+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++KY KHR DA+D  N TY++SVIEGDAL   +E +S E K VAS +GGSI+KS + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y++KGD ++KEE ++   EKA+GL+KAVE YL+AHPD Y
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159

Sequence Alignment: 10. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 183.2 bits 670,  Expect = 3e-48
 Identities = 99/158 62%, Positives = 135/158 85%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E++ TSVI P +LFKA+ LD+DNLI KV P A+K TEI+EG+GG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHR+D +D +N +YS+++IEGDAL+ V+E+++ +IK VASPDGGSI+K+T+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEEQ++A  EKAAGL+K VEAYL+A+PD Y
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159

Sequence Alignment: 11. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 177.4 bits 648,  Expect = 2e-46
 Identities = 97/158 61%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D EN +YS+++IEGDAL   +E +S E K VASP GGSI+KST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HPD Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 12. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 176.6 bits 645,  Expect = 3e-46
 Identities = 96/158 60%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D EN +YS+++IEGDAL   +E +S E K VASP GGSI+KST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A  EKA+ L+K +E YL  HPD Y
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 13. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 175.6 bits 641,  Expect = 6e-46
 Identities = 101/158 63%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI PARLFK + LDSDNLI KV P+AIKS EIIEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S F Y K++++ +D  N +Y +SVIEGDAL+  +E ++ EIK VASP GGSI+KS +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+T GD +LK+EQI+A  EKA+GL+KAVE YL+AH D Y
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY 159

Sequence Alignment: 14. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 175.6 bits 641,  Expect = 6e-46
 Identities = 100/158 63%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E + TSVIAPARLFK++ LD+DNLI KV P+ + S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY KHR+D +D  N  Y +S+IEG  L   +E +S EIK VA+P GGSI+K T+K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD  L EE+I+A  EK AGL+KAVE YLVAHP+ Y
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 172.7 bits 630,  Expect = 4e-45
 Identities = 94/158 59%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y K+R++ +D +N TYS+S+IEGD L+  +E ++ E K +ASPDGGSI+K+T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+ KGD ++KEE+++A  EKA+GL+K +EAYL+AH D Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 172.1 bits 628,  Expect = 6e-45
 Identities = 94/158 59%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y K+R++ +D +N TYS+S+IEGD L+  +E ++ E K +ASPDGGSI+K+T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+ KGD ++KEE+++A  EKA+GL+K +EAYL+AH D Y
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 17. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 171.9 bits 627,  Expect = 8e-45
 Identities = 93/158 58%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG+FT+  + TSVI P RLFKAL L++D LI K+ PQ++KS EI+EG+GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+ID LD +N  Y++S++EGDAL+  +E +S EIK VAS DGGS++KST+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE ++A  EKA GL+K +E YLVA+PD Y
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY 159

Sequence Alignment: 18. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 169.8 bits 619,  Expect = 3e-44
 Identities = 98/158 62%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K E+++A  EKA  LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAY 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 169.5 bits 618,  Expect = 4e-44
 Identities = 92/158 58%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKST+IIEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y K+R++ +D +N TYS+S+IEGD L+  +E ++ E K +ASPDGGSI+K+ + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+ KGD ++KEE+++A  EKA+GL+K +EAYL+AH D Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 20. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 169.3 bits 617,  Expect = 5e-44
 Identities = 98/158 62%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +ES+ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 168.5 bits 614,  Expect = 8e-44
 Identities = 95/157 60%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KHRID +D EN  Y +SVIEGDA++  +E +S E K VAS   GS++KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL+ HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158

Sequence Alignment: 22. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 166.9 bits 608,  Expect = 2e-43
 Identities = 97/157 61%, Positives = 118/157 75%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +ES+ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
             S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            +TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 23. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 166.1 bits 605,  Expect = 4e-43
 Identities = 95/158 60%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF++E + TSVI PARLFK++ LD+DNLI KV PQ     E +EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGG-SIMKSTT 118
            E S+FKY KH+++ +D  N  Y +S+IEG  L   +E +S EIK  A+P GG SI+K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            KY+TKG+  + EE+I+A  EKAAGL+KAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 165.8 bits 604,  Expect = 5e-43
 Identities = 96/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 165.6 bits 603,  Expect = 6e-43
 Identities = 94/157 59%, Positives = 124/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 26. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 165.6 bits 603,  Expect = 6e-43
 Identities = 94/157 59%, Positives = 124/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 27. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 165.3 bits 602,  Expect = 7e-43
 Identities = 95/158 60%, Positives = 120/158 75%, Gaps = 2/158 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E + TSVI PARLFK++ LD+DNLI KV PQ     E +EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGG-SIMKSTT 118
            E S+FKY KH+++ +D  N  Y +S+IEG  L   +E +S EIK  A+P GG SI+K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            KY+TKG+  + EE+I+A  EKAAGL+KAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 28. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 165.3 bits 602,  Expect = 7e-43
 Identities = 95/158 60%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E + TSVI PARLFK++ LD+DNLI KV PQ   S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGG-SIMKSTT 118
            E ++FKY KH+++ +D  N  Y +S+IEG  L   +E +S EIK  A+P GG SI+K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            KY+TKG+  + EE+I+A  EKAAGL+KAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 29. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 165.0 bits 601,  Expect = 9e-43
 Identities = 94/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE++ A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 30. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 165.0 bits 601,  Expect = 9e-43
 Identities = 96/158 60%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFKA+ LD D L+ KV P+A+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R+D +D  N  YSFSVIEG A+   +E V  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++TKGD ++  EQI+   EKA GLLKAVE+YL+AH D Y
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 159

Sequence Alignment: 31. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 165.0 bits 601,  Expect = 9e-43
 Identities = 95/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 32. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 165.0 bits 601,  Expect = 9e-43
 Identities = 96/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 33. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 164.5 bits 599,  Expect = 1e-42
 Identities = 93/157 59%, Positives = 124/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K +AS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 34. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 164.5 bits 599,  Expect = 1e-42
 Identities = 94/158 59%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF++E + TSVI PARLFK++ LD+DNLI KV PQ   S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGG-SIMKSTT 118
            E ++FKY KH+++ +D  N  Y +S+IEG  L   +E +  EIK  A+P GG SI+K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            KY+TKG+  + EE+I+A  EKAAGL+KAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 35. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 164.3 bits 598,  Expect = 1e-42
 Identities = 93/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFK + LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 36. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 164.0 bits 597,  Expect = 2e-42
 Identities = 93/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 37. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 164.0 bits 597,  Expect = 2e-42
 Identities = 93/157 59%, Positives = 124/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E++L  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAY 158

Sequence Alignment: 38. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 164.0 bits 597,  Expect = 2e-42
 Identities = 93/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 39. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 163.7 bits 596,  Expect = 2e-42
 Identities = 90/158 56%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES+ TS IAPARLFKA+ LD DNL+ K+ PQA++  EI+EGNGG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL--TVMESVSTEIKCVASPDGGSIMKSTT 118
            +   FKY KH+I+A+D E+ TYS+S+IEGDAL    +E ++ E K VAS DGG+++K+ +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  KYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            KY + GD Q+ EE+++   ++A  +LK VEAYL  HP+ Y
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAY 160

Sequence Alignment: 40. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 163.5 bits 595,  Expect = 3e-42
 Identities = 92/157 58%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KHRID +D +N  Y +SVIEGDA++  +E +S E K VA+   GS++KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL+ H D Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158

Sequence Alignment: 41. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 163.5 bits 595,  Expect = 3e-42
 Identities = 92/157 58%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 42. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 163.2 bits 594,  Expect = 3e-42
 Identities = 92/157 58%, Positives = 124/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E++S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 43. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 163.2 bits 594,  Expect = 3e-42
 Identities = 95/157 60%, Positives = 116/157 73%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +E++  SVI  ARLFKA+ LD D L+ KV P+A+ S E IEGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
             S FKY K R+D +D  N  YSFSVIEG A+   +E V  EIK VA+PDGGSI+K + K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            +TKGD ++  EQI+   EKA GLLKAVE+YL+AH D Y
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 158

Sequence Alignment: 44. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 163.2 bits 594,  Expect = 3e-42
 Identities = 93/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI++ + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 45. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 162.9 bits 593,  Expect = 4e-42
 Identities = 92/157 58%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KHRID +D EN  Y +SVIEGDA++  +E +S E K VAS   GS++KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TK D ++KEE+++A  EKA+ L+K +E YL+AH D Y
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158

Sequence Alignment: 46. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 162.9 bits 593,  Expect = 4e-42
 Identities = 91/157 57%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG++T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHR+D++D  + +Y++++IEGDALT  +E +S E K VAS   GS +KS + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 47. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 162.9 bits 593,  Expect = 4e-42
 Identities = 92/157 58%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 48. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 162.9 bits 593,  Expect = 4e-42
 Identities = 90/158 56%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+  +E +  E K V++P GG+I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 49. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 162.7 bits 592,  Expect = 4e-42
 Identities = 92/157 58%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 50. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 162.7 bits 592,  Expect = 4e-42
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI+K + K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 162.7 bits 592,  Expect = 4e-42
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 52. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 162.4 bits 591,  Expect = 5e-42
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 53. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 162.4 bits 591,  Expect = 5e-42
 Identities = 88/158 55%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+  +E +  E K V++P GG+++K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 54. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 162.1 bits 590,  Expect = 6e-42
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAY 159

Sequence Alignment: 55. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 161.9 bits 589,  Expect = 8e-42
 Identities = 92/156 58%, Positives = 123/156 78%, Gaps = 2/156 1%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GV+T+E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTKY 120
             S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            +TKGD ++ EE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAY 157

Sequence Alignment: 56. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 161.9 bits 589,  Expect = 8e-42
 Identities = 91/157 57%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A   KA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 57. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 161.6 bits 588,  Expect = 9e-42
 Identities = 91/157 57%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++   EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 58. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 161.6 bits 588,  Expect = 9e-42
 Identities = 94/158 59%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  YS+SVIEG  +   +E +S EIK VA+P+GGSI+K   K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQI+A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 59. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 161.4 bits 587,  Expect = 1e-41
 Identities = 92/157 58%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 60. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 161.4 bits 587,  Expect = 1e-41
 Identities = 89/158 56%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTV-MESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+I ++D  N TYS+S+IEGDAL+  +E +  E K V++P GG+I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKAA L+K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 61. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 161.4 bits 587,  Expect = 1e-41
 Identities = 94/158 59%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  YS+SVIEG  +   +E +S EIK VA+P+GGSI+K   K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQI+A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 62. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 160.8 bits 585,  Expect = 2e-41
 Identities = 91/158 57%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD +NLI KV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FKY K R++ +D  N  YS++VIEG  +   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++  E+I+   EK  GL++AVEAYL+AH D Y
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAY 159

Sequence Alignment: 63. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 160.6 bits 584,  Expect = 2e-41
 Identities = 92/157 58%, Positives = 116/157 73%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
               FKY K R+D +D  N  YS+S+IEG  +   +E +S EIK VA+PDGGSI+K + KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            +TKGD ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 64. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 160.6 bits 584,  Expect = 2e-41
 Identities = 89/158 56%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG +T+E++ TS I   +LFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+  +E +  E K V++P GG+I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 160.3 bits 583,  Expect = 2e-41
 Identities = 90/158 56%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +  ++E +S EIK VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 66. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 160.3 bits 583,  Expect = 2e-41
 Identities = 94/158 59%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E + TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  YS+SVIEG  +   +E +S EIK VA+P+GGSI+K   K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQI+A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 67. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 160.0 bits 582,  Expect = 3e-41
 Identities = 91/157 57%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++KEE+++   EKA GL+K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 68. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 159.8 bits 581,  Expect = 3e-41
 Identities = 90/157 57%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E + TSVI PARL+ A+ LD+DNLI K+ PQA+KSTEI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+ID +D +N  Y +SVIEGDA++  +E +S E K VAS   GS++KS + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL+ H D Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAY 158

Sequence Alignment: 69. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 159.3 bits 579,  Expect = 5e-41
 Identities = 89/157 56%, Positives = 120/157 76%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA   G +I KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+ KG+ ++KEE+++   EK  GL+K +E+YL  HPD Y
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 70. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 159.3 bits 579,  Expect = 5e-41
 Identities = 90/158 56%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 71. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 159.0 bits 578,  Expect = 6e-41
 Identities = 90/158 56%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 72. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 159.0 bits 578,  Expect = 6e-41
 Identities = 93/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +  +N  YS+SVIEG  +   +E +S EIK VA+PDG SI+K + K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++K EQI+A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 73. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 159.0 bits 578,  Expect = 6e-41
 Identities = 91/158 57%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +ES+ TSVI  ARLFKA+ L+ DNLI KV PQAI S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 74. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 158.2 bits 575,  Expect = 1e-40
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E + TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 75. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 157.4 bits 572,  Expect = 2e-40
 Identities = 88/157 56%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+  +E +  E K V++P G +I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HP  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158

Sequence Alignment: 76. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 157.2 bits 571,  Expect = 2e-40
 Identities = 88/158 55%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  AR+FKA+ LD D L+ KV PQAI S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 77. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 156.9 bits 570,  Expect = 2e-40
 Identities = 89/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
                FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 78. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 156.6 bits 569,  Expect = 3e-40
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++KY K R+D +D  N TYS++VIEGD L   +E V  E+K VA+P GGSI+K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+I+ A E A  LL+AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 79. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 156.1 bits 567,  Expect = 4e-40
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD +NLI KV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S  KY K R++ +D  N  YS++VIEG  +   +E +  EIK VA+PDGGSI+K T+K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++  E+I+   E+  GLLK VEAYL+AH   Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 80. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 155.1 bits 563,  Expect = 8e-40
 Identities = 90/149 60%, Positives = 112/149 75%, Gaps = 1/149 0%
Query  4    FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGEAS 63
            F +ES+ TSVI  ARLFKA+ L+ DNLI KV PQAI S E IEGNGGPGTIKKITF E S
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   KFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKYQT 122
             FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + KY+T
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDFQLKEEQIQAAIEKAAGLLKAVEAYLV 152
            KGD ++K E+++A  EK   LL+AVE+YL+
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 81. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 153.5 bits 557,  Expect = 3e-39
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++KY K R+D +D  N TYS++VIEGD L   +E V  E+K VA+P GGSI+K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 82. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 153.5 bits 557,  Expect = 3e-39
 Identities = 89/158 56%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S  KY K R++ +D  N  YS++VIEG  +   +E +  EIK VA+PDGGSI+K T+K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD ++  E+I+   E+  GLLK VEAYL+AH   Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 83. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 152.9 bits 555,  Expect = 4e-39
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++KY K R+D +D  N  YS++VIEGD L   +E V +E+K VA+P GGSI+K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 84. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 151.6 bits 550,  Expect = 9e-39
 Identities = 87/157 55%, Positives = 112/157 71%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
             S++KY K R+D +D  N TYS++VIEGD L   +E V  E+K VA+P GGSI+K ++K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            + KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158

Sequence Alignment: 85. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 150.0 bits 544,  Expect = 3e-38
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH D Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 86. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 150.0 bits 544,  Expect = 3e-38
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH D Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 87. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 149.5 bits 542,  Expect = 4e-38
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E +  SVI+ ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S++KY K R+D +D  N  YS++VIEGD L   +E V +E+K VA+P GGS +K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 88. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 149.3 bits 541,  Expect = 5e-38
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH D Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 89. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 147.9 bits 536,  Expect = 1e-37
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 147.4 bits 534,  Expect = 2e-37
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 91. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 147.4 bits 534,  Expect = 2e-37
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 92. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 147.2 bits 533,  Expect = 2e-37
 Identities = 83/156 53%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV T++ +  S + P +L+KA+ LD D L+ KVLP+AIK  +I+EG+G  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTV-MESVSTEIKCVASPDGGSIMKSTTK 119
            E S  K  K+R+DA+D +N TYS+++IEGD L    ES+S  IK VA PDGGSI K+ + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPD 156
            Y TKGD ++ EE+I+   EKAA ++KA+EAYL+A+PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 93. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 147.2 bits 533,  Expect = 2e-37
 Identities = 84/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGS++K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 94. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 146.6 bits 531,  Expect = 3e-37
 Identities = 84/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 95. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 146.6 bits 531,  Expect = 3e-37
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 96. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 146.4 bits 530,  Expect = 4e-37
 Identities = 85/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E   FK+ K R+D +D  N  YS++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 97. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 146.4 bits 530,  Expect = 4e-37
 Identities = 85/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  +S++VIEGD L   +E VS E+K VA+P GGSI+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 98. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 145.3 bits 526,  Expect = 7e-37
 Identities = 84/157 53%, Positives = 113/157 71%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
             S  KY K R++ +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            + KG  ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 99. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 145.1 bits 525,  Expect = 8e-37
 Identities = 83/149 55%, Positives = 108/149 72%, Gaps = 1/149 0%
Query  4    FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGEAS 63
            F +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S + IEGNGGPGTIKKI F E  
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   KFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKYQT 122
             FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG I+K + KY+T
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDFQLKEEQIQAAIEKAAGLLKAVEAYLV 152
            KG+ ++K EQ++A+ E    LL+AVE+YL+
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 100. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 145.1 bits 525,  Expect = 9e-37
 Identities = 83/156 53%, Positives = 110/156 70%, Gaps = 0/156 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG  T++ +  S I+  ++FKA+ LD D +I K LP+AI   + +EG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
            E S  K  KHRID LD EN TYS+S+IEG AL V ES+S  IK VA+PDGG I K+ + Y
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPD 156
              K D Q+ EE+I+A  E+A+G++K VEAYL+A+PD
Sbjct  121  TPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 143.7 bits 520,  Expect = 2e-36
 Identities = 83/158 52%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVF +E++  SV+  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E S FK+ K R+D +D  N  +S++VIEGD L   +E VS E+  VA+P GGSI+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 102. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 142.7 bits 516,  Expect = 5e-36
 Identities = 83/157 52%, Positives = 110/157 70%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
             S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            + KG  ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 103. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 139.3 bits 503,  Expect = 5e-35
 Identities = 81/157 51%, Positives = 108/157 68%, Gaps = 1/157 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVF +E++  SVI  ARLFK+  LD D LI KV PQ I S E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
               FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            + KG  ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 134.8 bits 486,  Expect = 1e-33
 Identities = 79/155 50%, Positives = 108/155 69%, Gaps = 2/155 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT E +  S +APA L+KAL  D+DN+I K L  + KS E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E  + K+  H+I+++D  N  YS+SV+ G AL    E ++ + K VA P+GGS  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPD 156
            Y+TKGD +  +++++    KA  L+KA+EAYL+AHPD
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD 156

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 132.8 bits 478,  Expect = 4e-33
 Identities = 77/134 57%, Positives = 102/134 76%, Gaps = 2/134 1%
Query  11   TSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGEASKFKYAKH 70
            TSVI P +LFKA+ LD+DNLI K+ PQA+KS EIIEG+GG GT+KKI +GE ++  Y KH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKYQTKGDFQLK 129
            +ID LD  N  YS+S+ EGDAL   +E +S EIK VAS   GSI+K+T+ Y+ KG  ++K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEQIQAAIEKAAGLLK 145
            EEQ++   E+AAGL+K
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 132.4 bits 477,  Expect = 6e-33
 Identities = 78/156 50%, Positives = 111/156 71%, Gaps = 5/156 3%
Query  1    MGV--FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKIT 58
            MGV  FTHES  T+ IAP RLFK L LD D+L+ K+L + +KS EI+EG+GG G+IK++ 
Sbjct  1    MGVNTFTHES--TTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMN 58
Query  59   FGEASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKST 117
            F E    KY KH+I  +D +N    +S+IEGD L   +ES++ ++K  A+ DGG + K+T
Sbjct  59   FVEGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTT 118
Query  118  TKYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            T+Y+TKGD  + EE+      KA  L+KA+EAYL+A+P +Y
Sbjct  119  TEYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 130.3 bits 469,  Expect = 2e-32
 Identities = 73/155 47%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E  + K+  H+I+++D  N  YS+S++ G AL    E ++ + K    P+GGS++K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155
            Y++KGD    E++++A   K+  L+KAVEAYL+A+P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 108. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 129.5 bits 466,  Expect = 4e-32
 Identities = 74/158 46%, Positives = 108/158 68%, Gaps = 1/158 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E    KY KH+I  +D +N    +S+IEGD L   +ES++ +IK  A+ +GG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD  + EE+     E+   + KAVEAYL+A+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 128.5 bits 462,  Expect = 8e-32
 Identities = 72/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTKY 120
              + K+  H+I+++D  N  YS+S++ G AL    E ++ + K    P+GGS++K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155
            ++KGD    E++++A   K+  L+KAVEAYL+A+P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 125.6 bits 451,  Expect = 6e-31
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 2/154 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            M VFT E Q TS +APA L+KAL  D+D ++ K +  + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E  + K+  H+I+ +D  N  YS+S++ G AL    E +S + K    P+GGS++K + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155
            Y++KGD    E++++A   K+  L+K +EAYL+A+P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 123.5 bits 443,  Expect = 3e-30
 Identities = 70/156 44%, Positives = 107/156 68%, Gaps = 3/156 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGVFT E + TS + PA+L+ A+  D+D++  K++   +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E  + K+  H+++++D  N  Y++SV+ G AL    E ++ E K V  P+GGSI K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            Y+TKGD +  EE+++    K  GL++A+E Y++A+P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 120.6 bits 432,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 104/154 67%, Gaps = 2/154 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            M VFT + Q TS +APA L+ AL  D+DN+I K +  + +S EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E  + K+  H+I+++D  N  YS+S++ G AL    E ++ + K     DGGS++K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155
            Y+ KGD    E++++A   K+  L+KAVEAYL+A+P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 119.8 bits 429,  Expect = 3e-29
 Identities = 72/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV   E   TS +  A+LFKAL LD D L+ +VLP AIK  EI+EG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            +AS +K  K++IDA+D E  T+S+S+I+GD L   ++S++  +  V + DGG    ST  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            + TKGD  + EE I+ A ++   ++KAVEAYL+A+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 115.4 bits 412,  Expect = 7e-28
 Identities = 68/152 44%, Positives = 102/152 67%, Gaps = 3/152 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV T E + TS + PA+LFKA  +D D L  K++P AI+S EI+EGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E  K  Y  H+IDA+D    TY +++  G  +  ++E VS + K  A+ DGGS +K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  L +E  Q   +K+ G++KA+E Y++++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 115.1 bits 411,  Expect = 9e-28
 Identities = 68/153 44%, Positives = 103/153 67%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV     +  S ++  ++++ ++LD D +  KVLPQ IKS EI+EG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            EA+++   K+++D +D     Y+++ I GD L  V+ESV  E   V   DGG I+K+TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            Y TKGD  L E++I+ A EK+A  +KAVEAYL+A+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 112.7 bits 402,  Expect = 5e-27
 Identities = 65/153 42%, Positives = 103/153 67%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV   E +  S ++  ++++ ++LD D +  KVLPQ IKS EI+EG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTV-MESVSTEIKCVASPDGGSIMKSTTK 119
            EA+++   K+++D +D     Y+++ I GD L   +ESV  +   V   DGG I+K+TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            Y TKGD  L E++++ A EK+A  +KAVEAYL+A+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 112.6 bits 402,  Expect = 6e-27
 Identities = 63/132 47%, Positives = 92/132 69%, Gaps = 1/132 0%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
            E    KY KH+I  +D +N    +S+IEGD L   +ES++ +IK  A+ +GG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YQTKGDFQLKEEQ 132
            Y+TKGD  + EE+
Sbjct  121  YHTKGDHVVSEEE 133

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 109.6 bits 390,  Expect = 4e-26
 Identities = 57/150 38%, Positives = 96/150 64%, Gaps = 1/150 0%
Query  7    ESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGEASKFK 66
            E + TS ++P+ +FKA+ +D D +  K  P+  KS + IEG+GG GTIK IT+ +   F 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTKYQTKGD 125
             +KH++DA+D  N + S+++ EGD L  ++ES +  +K + S DGGS+ K +  ++ KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  FQLKEEQIQAAIEKAAGLLKAVEAYLVAHPD 156
             +L +E +    E     +KA+E Y+++HP+
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPE 155

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 106.4 bits 378,  Expect = 4e-25
 Identities = 64/153 41%, Positives = 98/153 64%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MGV TH  + TS ++  ++F+ + +D D ++ K  P A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            +         RID ++ E  T+ +SVI+GD L   +ES+   +  V + DGGSI K+T  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  + EE I+ A E+   L+KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 103.3 bits 366,  Expect = 3e-24
 Identities = 63/153 41%, Positives = 96/153 62%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S       R DA++ E  TY  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  + EE I+ A E+   L+KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 102.5 bits 363,  Expect = 6e-24
 Identities = 63/153 41%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG  +H  + TS ++  ++F  + LD D +I K  P A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S       R DA++ E  TY  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  + EE I+ A  +   L+KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 101.4 bits 359,  Expect = 1e-23
 Identities = 62/153 40%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S       R DA++ E  TY  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  + EE I+ A  +   L+KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 100.8 bits 357,  Expect = 2e-23
 Identities = 62/153 40%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S       R DA++ E  TY  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  + EE I+ A  +   L+KA+EAYL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 98.8 bits 349,  Expect = 7e-23
 Identities = 61/153 39%, Positives = 94/153 61%, Gaps = 2/153 1%
Query  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
            MG  +H  + TS ++  ++F  + LD D +I K    A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
            E S       R DA++ E  +Y  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154
            ++TKGD  + EE I+ A  +   L+KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 91.0 bits 316,  Expect = 5e-21
 Identities = 50/50 100%, Positives = 50/50 100%, Gaps = 0/50 0%
Query  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 51
            GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 126. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 71.2 bits 243,  Expect = 9e-15
 Identities = 45/87 51%, Positives = 65/87 74%, Gaps = 18/87 20%
Query  55   KKITFGEASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSI 113
            KKITFGE S++ Y K                 +EGDAL+  +E +  E K V++P   +I
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  114  MKSTTKYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158
            +K+T+KY+TKGD ++KEE+++A  EKAA L+K +E YL  HP  Y
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 99

Sequence Alignment: 127. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 42.6 bits 130,  Expect = 9e-07
 Identities = 21/24 87%, Positives = 22/24 91%, Gaps = 0/24 0%
Query  2    GVFTHESQETSVIAPARLFKALFL 25
            GVFTHESQETSVI PARLFKA+ L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 128. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 44.6 bits 143,  Expect = 2e-06
 Identities = 38/140 27%, Positives = 61/140 43%, Gaps = 3/140 2%
Query  10   ETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGEASKFKYAK 69
            E SV   A L+  L  D   ++ KVLP+ +K  ++IEG+GG GTI    F       Y +
Sbjct  10   ELSVRLEA-LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQR 68
Query  70   HRIDALDPENCTYSFSVIEGDALTV-MESVSTEIKCVASPDGGSIMKSTTKYQTKGDFQL 128
              I  +D  +    + VIEG  L   +    T  K     +  +++     Y    D + 
Sbjct  69   EEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEE 128
Query  129  KEEQIQAAIEKAAGLLKAVEAYL 151
            K    + + +     L+ +E YL
Sbjct  129  KVTPTKTS-QSTLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.