The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG
EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK
YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK
Sequence Info Allergen Name Length Opt Bits Score E Value
ABZ81046 Que a 1.0301 160 1025 233.7 1.8e-63
AUH28179 Que m 1.0101 160 977 223.2 2.7e-60
ABZ81047 Que a 1.0401 160 948 216.8 2.3e-58
ABZ81045 Que a 1.0201 159 774 178.6 7.2e-47
APD76154 Jug r 5.0101 160 769 177.5 1.6e-46
QOL10866 Que ac 1.0101 159 762 175.9 4.5e-46
QGS84240 Que i 1.0101 159 757 174.8 9.6e-46
ACJ23864 Fag s 1.0101 160 728 168.5 8e-44
Q2I6V8 Pru p 1.0101 160 725 167.8 1.3e-43
O24248 Pru av 1 160 723 167.4 1.7e-43
CAD10374 Cas s 1 160 719 166.5 3.2e-43
CAA96549 Cor a 1.0301 160 712 165.0 9.2e-43
CAA96535 Mal d 1.0401 160 707 163.9 2e-42
CAA96537 Mal d 1.0403 160 703 163.0 3.6e-42
O50001 Pru ar 1 160 702 162.8 4.2e-42
CAA96536 Mal d 1.0402 160 693 160.8 1.7e-41
CAA54696.1 Bet v 1.0301 160 690 160.1 2.6e-41
AAO25113 Mal d 1.0304 159 686 159.2 4.8e-41
B6CQS9 Pru du 1.0101 160 685 159.0 5.6e-41
Q256S7 Fra a 1 160 679 157.7 1.4e-40
Q3T923 Fra a 1 160 677 157.3 1.9e-40
Q256S6 Fra a 1 160 670 155.7 5.5e-40
AAK13027 Mal d 1.0302 159 667 155.1 8.6e-40
CAA96548 Cor a 1.0201 160 667 155.1 8.7e-40
CAA96534 Mal d 1.0301 159 665 154.6 1.2e-39
AAB01362 Mal d 1.0201 159 661 153.8 2.2e-39
AAD26545 Mal d 1.0202 159 661 153.8 2.2e-39
Q256S2 Fra a 1 160 659 153.3 2.9e-39
Q256S4 Fra a 1 159 658 153.1 3.4e-39
P43186 Bet v 1.0204 160 658 153.1 3.4e-39
AAD26548 Mal d 1.0204 159 657 152.9 4e-39
AAD26554 Mal d 1.0106 159 657 152.9 4e-39
Q39427 Bet v 1.0205 160 657 152.9 4e-39
CAD32318 Mal d 1.0208 158 656 152.7 4.6e-39
AAD13683 Mal d 1.0206 159 656 152.7 4.6e-39
AAD26558 Mal d 1.0205 159 656 152.7 4.6e-39
AAD26547 Mal d 1.0203 159 655 152.4 5.4e-39
AAK13030 Mal d 1.0207 159 655 152.4 5.4e-39
AAG40329 Cor a 1.0402 161 655 152.4 5.4e-39
AAK13028 Mal d 1.0303 159 653 152.0 7.3e-39
AAD26546 Mal d 1.0103 159 652 151.8 8.5e-39
AAG40330 Cor a 1.0403 161 652 151.8 8.6e-39
AAD26552 Mal d 1.0104 159 650 151.3 1.1e-38
AAD29671 Mal d 1.0108 159 650 151.3 1.1e-38
AAD48405 Cor a 1.0401 161 650 151.3 1.2e-38
CAA04828.1 Bet v 1.0206 159 648 150.9 1.6e-38
CAB02217 Car b 1.0302 161 648 150.9 1.6e-38
AAD26555 Mal d 1.0107 159 647 150.7 1.8e-38
AAG40331 Cor a 1.0404 161 647 150.7 1.8e-38
CAA58646 Mal d 1.0101 159 646 150.5 2.1e-38
CAA50325 Cor a 1.0103 160 646 150.5 2.1e-38
O65200 Pyr c 1 159 645 150.2 2.5e-38
P43184 Bet v 1.0203 160 645 150.2 2.5e-38
AAD26553 Mal d 1.0105 159 644 150.0 2.9e-38
CAA54421 Bet v 1.0201 160 642 149.6 3.9e-38
CAA54481 Bet v 1.0202 160 642 149.6 3.9e-38
AAK13029 Mal d 1.0109 159 640 149.1 5.3e-38
AAB24432 Aln g 1 160 640 149.1 5.3e-38
CAA50327 Cor a 1.0101 160 639 148.9 6.2e-38
CAB02160 Bet v 1.0113 160 637 148.5 8.4e-38
CAA50328 Cor a 1.0102 160 637 148.5 8.4e-38
CAB02216 Car b 1.0301 161 637 148.5 8.4e-38
AFN42528 Can s 5.0101 161 636 148.3 9.8e-38
CAA88833 Mal d 1.0102 159 635 148.0 1.1e-37
P38948 Aln g 1 159 633 147.6 1.5e-37
CAB02206 Car b 1.0103 160 633 147.6 1.5e-37
Q08407 Cor a 1 159 632 147.4 1.8e-37
CAA33887 Bet v 1.0101 160 632 147.4 1.8e-37
CAA07329.1 Bet v 1.0118 160 632 147.4 1.8e-37
CAB02159 Bet v 1.0112 160 632 147.4 1.8e-37
CAM31908 Act c 8.0101 159 631 147.2 2.1e-37
CAB02156 Bet v 1.0109 160 631 147.2 2.1e-37
CAB02208 Car b 1.0105 160 630 146.9 2.4e-37
CAB02161 Bet v 1.0114 160 630 146.9 2.4e-37
CAB02207 Car b 1.0104 160 627 146.3 3.8e-37
CAA54487 Bet v 1.0106 160 627 146.3 3.8e-37
CAA54483 Bet v 1.0103 160 626 146.1 4.5e-37
CAA04827.1 Bet v 1.0116 159 623 145.4 7e-37
ABZ81042 Car b 1.0111 160 623 145.4 7.1e-37
ABZ81043 Car b 1.0112 160 623 145.4 7.1e-37
CAA54484 Bet v 1.0104 160 622 145.2 8.2e-37
ABZ81041 Car b 1.0110 160 622 145.2 8.2e-37
CAB02209 Car b 1.0106 160 620 144.7 1.1e-36
ABZ81044 Car b 1.0113 160 619 144.5 1.3e-36
ABZ81040 Car b 1.0109 160 619 144.5 1.3e-36
CAA07323.1 Bet v 1.0117 160 619 144.5 1.3e-36
CAB02155 Bet v 1.0108 160 618 144.3 1.5e-36
CAA54485 Bet v 1.0105 160 618 144.3 1.5e-36
CAA96547 Bet v 1.0115 160 618 144.3 1.5e-36
P38950 Car b 1 159 617 144.1 1.8e-36
CAB02157 Bet v 1.0110 160 617 144.1 1.8e-36
CAA54482 Bet v 1.0102 160 615 143.6 2.4e-36
ADK39021 Ost c 1.0101 160 614 143.4 2.8e-36
CAB02213 Car b 1.0107 160 612 143.0 3.8e-36
CAA50326 Cor a 1.0104 160 611 142.8 4.4e-36
CAB02158 Bet v 1.0111 160 610 142.5 5.1e-36
CAA54489 Bet v 1.0107 160 610 142.5 5.1e-36
CAA47357 Car b 1.0102 159 605 141.4 1.1e-35
ACF75030.1 Bet v 1.0207 150 604 141.2 1.2e-35
CAB02215 Car b 1.0108 160 602 140.8 1.7e-35
P38949 Car b 1 159 592 138.6 7.9e-35
ABC41615.1 Bet v 1.0119 150 565 132.7 4.6e-33
CAM31909 Act d 8.0101 157 558 131.1 1.4e-32
CAA42646 Gly m 4 158 531 125.2 8.5e-31
Q0Z8U9 Rub i 1.0101 137 525 123.9 1.8e-30
NP_001275580 Sola l 4.0201 160 518 122.3 6.2e-30
AHC08073 Sola l 4.0101 160 504 119.3 5.3e-29
CAA43636 Pha v 1 155 492 116.6 3.2e-28
CAA43637 Pha v 1 156 492 116.6 3.2e-28
P25985 Pha v 1 155 485 115.1 9.2e-28
AAQ91847 Ara h 8.0101 157 482 114.4 1.5e-27
Q2VU97 Vig r 1.0101 155 470 111.8 9e-27
EF436550 Ara h 8.0201 153 463 110.2 2.6e-26
CAA75803 Lyc e 4.0101 178 445 106.3 4.6e-25
CAA67246 Pet c PR10 155 443 105.9 5.5e-25
AAB92255 Tar o RAP 157 442 105.6 6.5e-25
P92918 Api g 1.0201 159 427 102.3 6.5e-24
AAL76932 Dau c 1.0201 154 421 101.0 1.6e-23
P49372 Api g 1 154 405 97.5 1.8e-22
CAB03716 Dau c 1.0104 154 387 93.5 2.8e-21
CAB06416 Dau c 1.0105 154 384 92.9 4.4e-21
BAA13604 Dau c 1.0102 154 383 92.7 5.1e-21
AAB01092 Dau c 1.0101 168 381 92.2 7.5e-21
CAB03715 Dau c 1.0103 154 369 89.6 4.3e-20
Q5ULZ4 Fra a 1.0101 100 271 68.0 8.6e-14
P85126 Que a 1.0101 50 260 65.6 2.4e-13
Q9S8Q4 Cas s 1 24 132 37.4 3.4e-05
Q9ZWP8 Vig r 6.0101 155 143 39.9 3.8e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 233.7 bits 1025,  Expect = 2e-63
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK 160
            YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK 160

Sequence Alignment: 2. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 223.2 bits 977,  Expect = 3e-60
 Identities = 153/159 96%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV  YESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSHLKHAKHRIDVIDPENFT+SFSVIEGDALFDKLENVSTETKIVASPDGGSIVKST K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            YQTKGDFQLTDELIRGGKEKAS VFKAVEAYLVAHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 3. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 216.8 bits 948,  Expect = 2e-58
 Identities = 148/160 92%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSI KSTSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK 160
            YQTKGDFQLTDELIRGGKEKAS VFKAVEAYLVAHPDLYK
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLYK 160

Sequence Alignment: 4. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 178.6 bits 774,  Expect = 7e-47
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E S +K+AKHRID +DPEN TYSFSVIEGDAL   +E+VSTE K VASPDGGSI+KST+K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLYK 160
            YQTKGDFQL +E I+   EKA+ ++KAVEAYLVAHPDLYK
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLYK 159

Sequence Alignment: 5. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 177.5 bits 769,  Expect = 2e-46
 Identities = 116/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYE+E  SVIPPARLFKAFVLD+DNLIPKVVPQA+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+ K+ KHR D ID  NFTY++SVIEGDAL DK+E +S ETKIVAS +GGSI+KS S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y++KGD ++ +E ++ GKEKAS +FKAVE YL+AHPD Y
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159

Sequence Alignment: 6. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 175.9 bits 762,  Expect = 4e-46
 Identities = 117/158 74%, Positives = 138/158 87%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+ YES++ SVIPPARLFKAFVLDSDNLI KV+P+A+KSTEIIEGNGGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E S +K+AKHRID +DPEN +YSFSVIEG+AL D + ++STE K VASPDGGSI+KST+K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            YQTKG FQL +E I+   EK + +FKAVEAYL+AHPDLY
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158

Sequence Alignment: 7. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 174.8 bits 757,  Expect = 1e-45
 Identities = 120/158 75%, Positives = 137/158 86%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV T+ES++ SVIPPARLFKAFVLDSDNLIPKV+PQA+KS E IEGNGGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E S +K++KHRID +DPEN TYSFSVIEGDAL D + +VSTE K VASPDGGSI KST+K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            YQTKGDFQL +E I+   EK + + KAVEAYL+AHPDLY
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 8. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 168.5 bits 728,  Expect = 8e-44
 Identities = 110/159 69%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESE  +VI PARLFKAFVLD+DNLIPKV PQA+KS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS++ + KHRID ID  NFTY+ ++IEGDA+ + LE ++ E K+VASPDGGSI+KSTSK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ ++ I+ GKE+AS +FKAVEAYL+A+P  Y
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159

Sequence Alignment: 9. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 167.8 bits 725,  Expect = 1e-43
 Identities = 106/159 66%, Positives = 131/159 82%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESE  S IPP RLFKAFVLD+DNL+PK+ PQA+K +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID ID EN +YS+++IEGDAL D LE +S ETK+VASP GGSI+KSTS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HPD Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 10. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 167.4 bits 723,  Expect = 2e-43
 Identities = 105/159 66%, Positives = 132/159 83%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESE  S IPP RLFKAFVLD+DNL+PK+ PQA+K +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID ID EN++YS+++IEGDAL D LE +S ETK+VASP GGSI+KSTS 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKAS +FK +E YL  HPD Y
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 11. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 166.5 bits 719,  Expect = 3e-43
 Identities = 110/159 69%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E+E  S IPP RLFKAFVLD+DNLIPK+ P+A+KS EIIEGNGGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS++K+ KHRID ID  NFTY +SVIEGD + + LE +S E KIVASPDGGSI+K+TSK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E +  GKEKA+ +FKAVEAYL+AH D Y
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY 159

Sequence Alignment: 12. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 165.0 bits 712,  Expect = 9e-43
 Identities = 110/159 69%, Positives = 129/159 81%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIPPARLFK FVLDSDNLIPKV P+A+KS EIIEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS + + K++++ ID  NF+Y +SVIEGDAL DKLE ++ E KIVASP GGSI+KS SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+T GD +L DE I+ GKEKAS +FKAVE YL+AH D Y
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 163.9 bits 707,  Expect = 2e-42
 Identities = 103/159 64%, Positives = 132/159 83%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP  RLFKAF+LD DNLIPK+ PQA+KSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + K+R++ ID +NFTYS+S+IEGD L DKLE ++ ETK++ASPDGGSI+K+TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+ KGD ++ +E ++ GKEKAS +FK +EAYL+AH D Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 163.0 bits 703,  Expect = 4e-42
 Identities = 103/159 64%, Positives = 132/159 83%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP  RLFKAF+LD DNLIPK+ PQA+KSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + K+R++ ID +NFTYS+S+IEGD L DKLE ++ ETK++ASPDGGSI+K+TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+ KGD ++ +E ++ GKEKAS +FK +EAYL+AH D Y
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 15. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 162.8 bits 702,  Expect = 4e-42
 Identities = 102/159 64%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYE+E  SVIPP +LFKAF+LD+DNLIPKV P A+K TEI+EG+GG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHR+D ID +N++YS+++IEGDAL D +EN++ + K+VASPDGGSIVK+TS 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA+ +FK VEAYL+A+PD Y
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 160.8 bits 693,  Expect = 2e-41
 Identities = 101/159 63%, Positives = 131/159 82%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP  RLFKAF+LD DNLIPK+ PQA+KST+IIEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + K+R++ ID +NFTYS+S+IEGD L DKLE ++ ETK++ASPDGGSI+K+ S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+ KGD ++ +E ++ GKEKAS +FK +EAYL+AH D Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 17. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 160.1 bits 690,  Expect = 3e-41
 Identities = 106/159 66%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVI PARLFK+FVLD+DNLIPKV P+ + S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH+K+ KHR+D ID  NF Y +S+IEG  L D LE +S E KIVA+P GGSI+K TSK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD  L +E I+ GKEK + +FKAVE YLVAHP+ Y
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 159.2 bits 686,  Expect = 5e-41
 Identities = 103/158 65%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESE  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS   + KHRID +D ENF Y +SVIEGDA+ + +E +S ETK+VAS   GS++KSTS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158

Sequence Alignment: 19. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 159.0 bits 685,  Expect = 6e-41
 Identities = 97/159 61%, Positives = 130/159 81%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG+FTY  E  SVIPP RLFKA+VL++D LIPK+ PQ++KS EI+EG+GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH  + KH+ID +D +NF Y++S++EGDAL DK+E +S E K+VAS DGGS++KSTS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA+ +FK +E YLVA+PD Y
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY 159

Sequence Alignment: 20. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 157.7 bits 679,  Expect = 1e-40
 Identities = 99/159 62%, Positives = 127/159 79%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P GG+I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 157.3 bits 677,  Expect = 2e-40
 Identities = 98/159 61%, Positives = 127/159 79%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P GG+++K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 155.7 bits 670,  Expect = 6e-40
 Identities = 98/159 61%, Positives = 126/159 79%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG +TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P GG+I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 155.1 bits 667,  Expect = 9e-40
 Identities = 100/158 63%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESE  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS   + KHRID +D +NF Y +SVIEGDA+ + +E +S ETK+VA+   GS++KSTS 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ H D Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158

Sequence Alignment: 24. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 155.1 bits 667,  Expect = 9e-40
 Identities = 99/159 62%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD +NLIPKV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R++ +D  NF YS++VIEG  + DK+E +  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+GGKEK   +F+AVEAYL+AH D Y
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAY 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 154.6 bits 665,  Expect = 1e-39
 Identities = 100/158 63%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS   + KHRID +D ENF Y +SVIEGDA+ + +E +S ETK+VAS   GS++KSTS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TK D ++ +E ++ GKEKAS +FK +E YL+AH D Y
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158

Sequence Alignment: 26. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 153.8 bits 661,  Expect = 2e-39
 Identities = 97/158 61%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 27. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 153.8 bits 661,  Expect = 2e-39
 Identities = 97/158 61%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 28. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 153.3 bits 659,  Expect = 3e-39
 Identities = 96/159 60%, Positives = 126/159 79%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH  + KH+I  ID  N TYS+S+IEGDAL + +E +  ETK+V++P GG+I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA+ +FK +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 29. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 153.1 bits 658,  Expect = 3e-39
 Identities = 98/158 62%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P G +I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158

Sequence Alignment: 30. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 153.1 bits 658,  Expect = 3e-39
 Identities = 100/159 62%, Positives = 123/159 77%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YESE  SVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 31. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 152.9 bits 657,  Expect = 4e-39
 Identities = 96/158 60%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK++AS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 32. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 152.9 bits 657,  Expect = 4e-39
 Identities = 97/158 61%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +EN+S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 33. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 152.9 bits 657,  Expect = 4e-39
 Identities = 99/159 62%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E K+VA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KEKA  +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAY 159

Sequence Alignment: 34. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 152.7 bits 656,  Expect = 5e-39
 Identities = 97/157 61%, Positives = 126/157 80%, Gaps = 1/157 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GV+TYE+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            GS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            +TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAY 157

Sequence Alignment: 35. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 152.7 bits 656,  Expect = 5e-39
 Identities = 96/158 60%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFK FVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 36. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 152.7 bits 656,  Expect = 5e-39
 Identities = 97/158 61%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E +  GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 37. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 152.4 bits 655,  Expect = 5e-39
 Identities = 96/158 60%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E++L  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAY 158

Sequence Alignment: 38. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 152.4 bits 655,  Expect = 5e-39
 Identities = 96/158 60%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 39. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 152.4 bits 655,  Expect = 5e-39
 Identities = 100/159 62%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF+YE E  SVIPPARLFK+FVLD+DNLIPKV PQ +   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGG-SIVKSTS 119
            EGS +K+ KH+++ ID  NF Y +S+IEG  L   LE +S E K+ A+P GG SI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            KY+TKG+  +++E I+ GKEKA+ +FKAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 40. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 152.0 bits 653,  Expect = 7e-39
 Identities = 98/158 62%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYE E  SVIPPARL+ AFVLD+DNLIPK+ PQA+KSTEI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS   + KH+ID +D +NF Y +SVIEGDA+ + +E +S ETK+VAS   GS++KS S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ H D Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAY 158

Sequence Alignment: 41. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 151.8 bits 652,  Expect = 8e-39
 Identities = 96/158 60%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 42. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 151.8 bits 652,  Expect = 9e-39
 Identities = 100/159 62%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVIPPARLFK+FVLD+DNLIPKV PQ +   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGG-SIVKSTS 119
            EGS +K+ KH+++ ID  NF Y +S+IEG  L   LE +S E K+ A+P GG SI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            KY+TKG+  +++E I+ GKEKA+ +FKAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 43. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 151.3 bits 650,  Expect = 1e-38
 Identities = 96/158 60%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 44. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 151.3 bits 650,  Expect = 1e-38
 Identities = 96/158 60%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 45. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 151.3 bits 650,  Expect = 1e-38
 Identities = 100/159 62%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVIPPARLFK+FVLD+DNLIPKV PQ + S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGG-SIVKSTS 119
            EG+ +K+ KH+++ ID  NF Y +S+IEG  L   LE +S E K+ A+P GG SI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            KY+TKG+  + +E I+ GKEKA+ +FKAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 150.9 bits 648,  Expect = 2e-38
 Identities = 98/158 62%, Positives = 122/158 77%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YESE  SVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            GS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E K+VA+PDGGSI+K ++KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            +TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 47. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 150.9 bits 648,  Expect = 2e-38
 Identities = 98/159 61%, Positives = 123/159 77%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD +NLIPKV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R++ +D  NF YS++VIEG  + DK+E +  E KIVA+PDGGSI+K TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+GGKE+   ++K VEAYL+AH   Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 48. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 150.7 bits 647,  Expect = 2e-38
 Identities = 95/158 60%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GK KA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 49. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 150.7 bits 647,  Expect = 2e-38
 Identities = 99/159 62%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF+YE E  SVIPPARLFK+FVLD+DNLIPKV PQ + S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGG-SIVKSTS 119
            EG+ +K+ KH+++ ID  NF Y +S+IEG  L   LE +  E K+ A+P GG SI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            KY+TKG+  + +E I+ GKEKA+ +FKAVEAYL+AHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 50. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 150.5 bits 646,  Expect = 2e-38
 Identities = 96/158 60%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 51. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 150.5 bits 646,  Expect = 2e-38
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI+K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E I+G KE A ++++AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 52. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 150.2 bits 645,  Expect = 2e-38
 Identities = 94/158 59%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG++T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHR+D ID  +++Y++++IEGDAL D +E +S E K+VAS   GS +KS S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 53. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 150.2 bits 645,  Expect = 2e-38
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YESE  SVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 54. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 150.0 bits 644,  Expect = 3e-38
 Identities = 96/158 60%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 55. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 149.6 bits 642,  Expect = 4e-38
 Identities = 97/159 61%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 56. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 149.6 bits 642,  Expect = 4e-38
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YESE  SVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 57. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 149.1 bits 640,  Expect = 5e-38
 Identities = 96/158 60%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 58. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 149.1 bits 640,  Expect = 5e-38
 Identities = 100/159 62%, Positives = 123/159 77%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD D L+PKV P+A+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R+D +D  NF YSFSVIEG A+ D LE V  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++TKGD ++  E I+  KEKA  ++KAVE+YL+AH D Y
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 159

Sequence Alignment: 59. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 148.9 bits 639,  Expect = 6e-38
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI+K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 60. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 148.5 bits 637,  Expect = 8e-38
 Identities = 94/159 59%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGGSI+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 61. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 148.5 bits 637,  Expect = 8e-38
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS  K+ K R+D +D  NF YS++VIEGD L DKLE V +E KIVA+P GGSI+K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 62. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 148.5 bits 637,  Expect = 8e-38
 Identities = 97/159 61%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD + LIPKV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K+ K R++ +D  NF YS++VIEG  + DK+E +  E KIVA+PDGGSI+K TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+GGKE+   ++K VEAYL+AH   Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 63. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 148.3 bits 636,  Expect = 1e-37
 Identities = 93/159 58%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFTYESE  S I PARLFKAFVLD DNL+PK+ PQA++  EI+EGNGG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALF-DKLENVSTETKIVASPDGGSIVKSTS 119
            +G  +K+ KH+I+ ID E++TYS+S+IEGDAL  ++LE ++ E+K+VAS DGG+++K+ S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            KY + GD Q+ +E ++ G+++A++++K VEAYL  HP+ Y
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAY 160

Sequence Alignment: 64. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 148.0 bits 635,  Expect = 1e-37
 Identities = 94/158 59%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA   G +I KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+ KG+ ++ +E ++ GKEK   +FK +E+YL  HPD Y
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 65. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 147.6 bits 633,  Expect = 2e-37
 Identities = 99/158 62%, Positives = 122/158 77%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YE+E  SVIP ARLFKAF+LD D L+PKV P+A+ S E IEGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            GS +K+ K R+D +D  NF YSFSVIEG A+ D LE V  E KIVA+PDGGSI+K ++K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            +TKGD ++  E I+  KEKA  ++KAVE+YL+AH D Y
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 158

Sequence Alignment: 66. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 147.6 bits 633,  Expect = 2e-37
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH D Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 67. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 147.4 bits 632,  Expect = 2e-37
 Identities = 96/158 60%, Positives = 119/158 75%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            GS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI+K +SK+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            + KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158

Sequence Alignment: 68. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 147.4 bits 632,  Expect = 2e-37
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGGSI+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 69. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 147.4 bits 632,  Expect = 2e-37
 Identities = 94/159 59%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E K+VA+PDGGSI++ ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 70. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 147.4 bits 632,  Expect = 2e-37
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGGSI+K ++K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 71. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 147.2 bits 631,  Expect = 2e-37
 Identities = 91/157 57%, Positives = 127/157 80%, Gaps = 0/157 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV TY+ E  S +PP +L+KAF+LD D L+PKV+P+A+K  +I+EG+G  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGSH K  K+R+D ID +N+TYS+++IEGD L +K+E++S   KIVA PDGGSI K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPD 157
            Y TKGD ++++E I+ GKEKA+E+FKA+EAYL+A+PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 72. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 147.2 bits 631,  Expect = 2e-37
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGGSI+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 73. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 146.9 bits 630,  Expect = 2e-37
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH D Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 74. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 146.9 bits 630,  Expect = 2e-37
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGGSI+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAY 159

Sequence Alignment: 75. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 146.3 bits 627,  Expect = 4e-37
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L D LE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH D Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 76. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 146.3 bits 627,  Expect = 4e-37
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF YS+SVIEG  + D LE +S E KIVA+P+GGSI+K  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 77. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 146.1 bits 626,  Expect = 4e-37
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF YS+SVIEG  + D LE +S E KIVA+P+GGSI+K  +K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 78. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 145.4 bits 623,  Expect = 7e-37
 Identities = 93/158 58%, Positives = 119/158 75%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            G  +K+ K R+D +D  NF YS+S+IEG  + D LE +S E KIVA+PDGGSI+K ++KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            +TKGD ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 79. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 145.4 bits 623,  Expect = 7e-37
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 80. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 145.4 bits 623,  Expect = 7e-37
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 81. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 145.2 bits 622,  Expect = 8e-37
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF YS+SVIEG  + D LE +S E KIVA+P+GGSI+K  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 82. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 145.2 bits 622,  Expect = 8e-37
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGS+VK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 83. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 144.7 bits 620,  Expect = 1e-36
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 84. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 144.5 bits 619,  Expect = 1e-36
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K  K R+D +D  NF YS++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 85. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 144.5 bits 619,  Expect = 1e-36
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 86. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 144.5 bits 619,  Expect = 1e-36
 Identities = 91/159 57%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 87. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 144.3 bits 618,  Expect = 2e-36
 Identities = 91/159 57%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 88. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 144.3 bits 618,  Expect = 2e-36
 Identities = 92/159 57%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YESE  SVIP ARLFKAF+L+ DNLIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 89. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 144.3 bits 618,  Expect = 2e-36
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +  +NF YS+SVIEG  + D LE +S E KIVA+PDG SI+K ++K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 90. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 144.1 bits 617,  Expect = 2e-36
 Identities = 95/158 60%, Positives = 121/158 76%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YE+E  SVIP ARLFKAF+LD + LIPKV PQA+ S E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            GS +K+ K R++ ID  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            + KG  ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 91. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 144.1 bits 617,  Expect = 2e-36
 Identities = 91/159 57%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 92. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 143.6 bits 615,  Expect = 2e-36
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 93. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 143.4 bits 614,  Expect = 3e-36
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 94. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 143.0 bits 612,  Expect = 4e-36
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF +S++VIEGD L DKLE VS E KIVA+P GGSI+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 95. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 142.8 bits 611,  Expect = 4e-36
 Identities = 93/159 58%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE E  SVI  ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS  K+ K R+D +D  NF YS++VIEGD L DKLE V +E KIVA+P GGS +K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 96. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 142.5 bits 610,  Expect = 5e-36
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
             G  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 97. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 142.5 bits 610,  Expect = 5e-36
 Identities = 89/159 55%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SVIP AR+FKAF+LD D L+PKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 98. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 141.4 bits 605,  Expect = 1e-35
 Identities = 93/158 58%, Positives = 118/158 74%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            GS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            + KG  ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 99. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 141.2 bits 604,  Expect = 1e-35
 Identities = 92/150 61%, Positives = 116/150 77%, Gaps = 0/150 0%
Query  4    FTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGEGS 63
            F YESE  SVIP ARLFKAF+L+ DNLIPKV PQA+ S E IEGNGGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   HLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQT 123
             +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI+K ++KY+T
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDFQLTDELIRGGKEKASEVFKAVEAYLV 153
            KGD ++  E ++  KEK   +++AVE+YL+
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 100. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 140.8 bits 602,  Expect = 2e-35
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVF YE+E  SV+P ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +K  K R+D +D  NF +S++VIEGD L DKLE VS E  IVA+P GGSI+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 101. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 138.6 bits 592,  Expect = 8e-35
 Identities = 91/158 57%, Positives = 116/158 73%, Gaps = 0/158 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVF YE+E  SVIP ARLFK++VLD D LIPKV PQ + S E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
            G  +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            + KG  ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 102. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 132.7 bits 565,  Expect = 5e-33
 Identities = 84/150 56%, Positives = 111/150 74%, Gaps = 0/150 0%
Query  4    FTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGEGS 63
            F YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S + IEGNGGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   HLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQT 123
             +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG I+K ++KY+T
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDFQLTDELIRGGKEKASEVFKAVEAYLV 153
            KG+ ++  E ++  KE    +++AVE+YL+
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 131.1 bits 558,  Expect = 1e-32
 Identities = 88/156 56%, Positives = 114/156 73%, Gaps = 1/156 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG  TY+ E  S I   ++FKAFVLD D +IPK +P+A+   + +EG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS  K  KHRID +D ENFTYS+S+IEG AL D +E++S   KIVA+PDGG I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPD 157
            Y  K D Q+++E I+ GKE+AS +FK VEAYL+A+PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 125.2 bits 531,  Expect = 8e-31
 Identities = 83/156 53%, Positives = 112/156 71%, Gaps = 1/156 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E E  S + PA L+KA+V D+DN+IPK +  ++KS E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E    K   H+I+ ID  N+ YS+SV+ G AL D  E ++ ++K+VA P+GGS  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPD 157
            Y+TKGD +   + ++ GK KA  +FKA+EAYL+AHPD
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD 156

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 123.9 bits 525,  Expect = 2e-30
 Identities = 79/134 58%, Positives = 106/134 79%, Gaps = 1/134 0%
Query  12   SVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGEGSHLKHAKHR 71
            SVIPP +LFKAFVLD+DNLIPK+ PQA+KS EIIEG+GG GT+KKI +GEG+   + KH+
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   IDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQTKGDFQLTD 131
            ID +D  NF YS+S+ EGDAL DK+E +S E K+VAS   GSI+K+TS Y+ KG  ++ +
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  ELIRGGKEKASEVFK 146
            E ++ GKE+A+ +FK
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 122.3 bits 518,  Expect = 6e-30
 Identities = 77/159 48%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV T+  E  + I P RLFK +VLD D+L+PK++ + +KS EI+EG+GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ KH+I VID +N+   +S+IEGD L DKLE+++ + K  A+ DGG + K+T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD  +++E    GK KA ++FKA+EAYL+A+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 119.3 bits 504,  Expect = 5e-29
 Identities = 76/159 47%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV TY  E  + I P RLFKA+VLD DNL+PK++ Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ KH+I VID +N+   +S+IEGD L +KLE+++ + K  A+ +GG + K+T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD  +++E    G+E+   + KAVEAYL+A+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 116.6 bits 492,  Expect = 3e-28
 Identities = 73/155 47%, Positives = 109/155 70%, Gaps = 1/155 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            M VFT+E +  S + PA L+KA+V D+D ++PK V  ++KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E    K   H+I+ ID  N+ YS+S++ G AL D  E +S ++K+   P+GGS+VK + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156
            Y++KGD    ++ ++ GK K+  +FK +EAYL+A+P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 116.6 bits 492,  Expect = 3e-28
 Identities = 71/156 45%, Positives = 108/156 69%, Gaps = 0/156 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E +  S + PA L+KA   D+D + PK +P ++KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E    K   H+I+ ID  N+ YS+S++ G AL +  E ++ ++K+   P+GGS++K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156
            Y++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 115.1 bits 485,  Expect = 9e-28
 Identities = 70/155 45%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
            GVFT+E +  S + PA L+KA   D+D + PK +P ++KS EI+EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
                K   H+I+ ID  N+ YS+S++ G AL +  E ++ ++K+   P+GGS++K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156
            ++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 114.4 bits 482,  Expect = 1e-27
 Identities = 74/157 47%, Positives = 109/157 69%, Gaps = 2/157 1%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGVFT+E E  S +PPA+L+ A + D+D++ PK++   +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E    K   H+++ ID  N+ Y++SV+ G AL    E ++ ETK+V  P+GGSI K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159
            Y+TKGD +  +E ++ GK K   +F+A+E Y++A+P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 111.8 bits 470,  Expect = 9e-27
 Identities = 72/155 46%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            M VFT++ +  S + PA L+ A+  D+DN+IPK V  +++S EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E    K   H+I+ +D  N+ YS+S++ G AL D  E ++ +TKI    DGGS++K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156
            Y+ KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 110.2 bits 463,  Expect = 3e-26
 Identities = 71/153 46%, Positives = 107/153 69%, Gaps = 2/153 1%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV T+E E  S +PPA+LFKA V+D D L PK++P A++S EI+EGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E     +  H+ID ID   +TY +++  G  + + LE VS +TK+ A+ DGGS +K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  L DE+ +  K+K+  +FKA+E Y++++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 106.3 bits 445,  Expect = 5e-25
 Identities = 67/146 45%, Positives = 103/146 70%, Gaps = 0/146 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV TY  E  + I P RLFKA+VLD DNL+PK++ Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EG  +K+ KH+I VID +N+   +S+IEGD L +KLE+++ + K  A+ +GG + K+T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFK 146
            Y+TKGD  +++E    G+ +  E F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 105.9 bits 443,  Expect = 6e-25
 Identities = 68/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV   E    S +P A+LFKA+ LD D L+P+V+P A+K  EI+EG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            + S  K  K++ID ID E FT+S+S+I+GD L+  +++++     V + DGG    ST+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            + TKGD  + +E I+   ++ + +FKAVEAYL+A+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 105.6 bits 442,  Expect = 7e-25
 Identities = 64/151 42%, Positives = 98/151 64%, Gaps = 0/151 0%
Query  7    ESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGEGSHLK 66
            E E  S + P+ +FKAFV+D D + PK  P+  KS + IEG+GG GTIK IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   HAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQTKGD 126
             +KH++D ID  NF+ S+++ EGD L   +E+ +   K + S DGGS+ K +  ++ KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  FQLTDELIRGGKEKASEVFKAVEAYLVAHPD 157
             +LTDE +   KE   + FKA+E Y+++HP+
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPE 155

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 102.3 bits 427,  Expect = 6e-24
 Identities = 68/154 44%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV     E  S +   ++++ F+LD D + PKV+PQ +KS EI+EG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E +     K+++DVID   + Y+++ I GD L D LE+V  E  +V   DGG IVK+T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            Y TKGD  L ++ I+   EK++  FKAVEAYL+A+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 101.0 bits 421,  Expect = 2e-23
 Identities = 65/154 42%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV   E E  S +   ++++ F+LD D + PKV+PQ +KS EI+EG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            E +     K+++DVID   + Y+++ I GD L + LE+V  +  +V   DGG IVK+T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            Y TKGD  L ++ ++   EK++  FKAVEAYL+A+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 97.5 bits 405,  Expect = 2e-22
 Identities = 64/154 41%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MGV T+  E  S +   ++F+ FV+D D ++PK  P A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            +G  +     RID ++ E +T+ +SVI+GD L+  +E++     +V + DGGSI K+T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  + +E I+   E+ + +FKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 93.5 bits 387,  Expect = 3e-21
 Identities = 61/154 39%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG  ++  E  S +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +     R D ++ E +TY  +VI+GD L+  +E++ T   +V + DGGSI K+T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  + +E I+   E+ + +FKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 92.9 bits 384,  Expect = 4e-21
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG  ++  E  S +   ++F   VLD D +IPK  P A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +     R D ++ E +TY  +VI+GD L+  +E++ T   +V + DGGSI K+T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 92.7 bits 383,  Expect = 5e-21
 Identities = 60/154 38%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG  ++  E  S +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +     R D ++ E +TY  +VI+GD L++ +E++ T   +V + DGGSI K+T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 92.2 bits 381,  Expect = 8e-21
 Identities = 60/154 38%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG  ++  E  S +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +     R D ++ E +TY  +VI+GD L++ +E++ T   +V + DGGSI K+T+ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 89.6 bits 369,  Expect = 4e-20
 Identities = 59/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
            MG  ++  E  S +   ++F   VLD D +IPK    A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
            EGS +     R D ++ E ++Y  +VI+GD L+  +E++ T   +V + DGGSI K+T+ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 68.0 bits 271,  Expect = 9e-14
 Identities = 57/99 57%, Positives = 77/99 77%, Gaps = 39/99 39%
Query  22   AFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGEGSHLKHAKHRIDVIDPENFT 81
            AFVLD+DNLIPK                      KITFGEGS+                 
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQ----------------- 21
Query  82   YSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRGGKEKA 141
            Y +  +EGDAL D LE +  ETK+V++P   +I+K+TSKY+TKGD ++ +E ++ GKEKA
Sbjct  22   YGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  SEVFKAVEAYLVAHPDLY 159
            + +FK +E YL  HP  Y
Sbjct  82   AHLFKLIEGYLKDHPSEY 99

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 65.6 bits 260,  Expect = 2e-13
 Identities = 40/50 80%, Positives = 46/50 92%, Gaps = 0/50 0%
Query  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGP 51
            GVFT+ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 37.4 bits 132,  Expect = 3e-05
 Identities = 20/24 83%, Positives = 23/24 95%, Gaps = 0/24 0%
Query  2    GVFTYESEDASVIPPARLFKAFVL 25
            GVFT+ES++ SVIPPARLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 128. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 39.9 bits 143,  Expect = 4e-05
 Identities = 36/126 28%, Positives = 58/126 46%, Gaps = 7/126 5%
Query  24   VLDSD--NLIPKVVPQALKSTEIIEGNGGPGTIKKITFGEGSHLKHAKHRIDVIDPENFT 81
            VL  D   ++PKV+P+ +K  ++IEG+GG GTI    F       + +  I   D  +  
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRGGKEKA 141
              + VIEG  L   L    T  K+    +  ++V     Y    D +   E +   K   
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIE---EKVTPTKTSQ 137
Query  142  SEV--FKAVEAYL 152
            S +  ++ +E YL
Sbjct  138  STLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.