The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG
EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH
YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q2I6V8 Pru p 1.0101 160 1043 252.5 4.1e-69
O24248 Pru av 1 160 1022 247.6 1.2e-67
AAD26545 Mal d 1.0202 159 922 224.2 1.4e-60
AAB01362 Mal d 1.0201 159 922 224.2 1.4e-60
AAD26548 Mal d 1.0204 159 918 223.2 2.6e-60
AAD13683 Mal d 1.0206 159 917 223.0 3.1e-60
AAK13030 Mal d 1.0207 159 916 222.8 3.6e-60
AAD26547 Mal d 1.0203 159 916 222.8 3.6e-60
AAD26558 Mal d 1.0205 159 914 222.3 5e-60
CAD32318 Mal d 1.0208 158 902 219.5 3.5e-59
Q256S7 Fra a 1 160 895 217.8 1.1e-58
Q3T923 Fra a 1 160 893 217.4 1.5e-58
O65200 Pyr c 1 159 887 216.0 4e-58
Q256S6 Fra a 1 160 886 215.7 4.8e-58
AAD26546 Mal d 1.0103 159 878 213.9 1.7e-57
AAD26552 Mal d 1.0104 159 876 213.4 2.4e-57
Q256S2 Fra a 1 160 875 213.2 2.8e-57
Q256S4 Fra a 1 159 874 212.9 3.3e-57
AAD29671 Mal d 1.0108 159 869 211.8 7.5e-57
AAD26555 Mal d 1.0107 159 867 211.3 1e-56
CAA58646 Mal d 1.0101 159 864 210.6 1.7e-56
AAD26554 Mal d 1.0106 159 863 210.3 2e-56
AAD26553 Mal d 1.0105 159 863 210.3 2e-56
CAA88833 Mal d 1.0102 159 860 209.6 3.2e-56
AAK13029 Mal d 1.0109 159 858 209.2 4.5e-56
CAA96535 Mal d 1.0401 160 840 205.0 8.3e-55
CAA96536 Mal d 1.0402 160 840 205.0 8.3e-55
CAA96537 Mal d 1.0403 160 840 205.0 8.3e-55
O50001 Pru ar 1 160 839 204.7 9.8e-55
AAO25113 Mal d 1.0304 159 836 204.0 1.6e-54
AAK13027 Mal d 1.0302 159 817 199.6 3.5e-53
CAA96534 Mal d 1.0301 159 812 198.4 7.8e-53
AAK13028 Mal d 1.0303 159 806 197.0 2.1e-52
APD76154 Jug r 5.0101 160 799 195.4 6.5e-52
B6CQS9 Pru du 1.0101 160 790 193.2 2.8e-51
ACJ23864 Fag s 1.0101 160 767 187.9 1.2e-49
CAD10374 Cas s 1 160 762 186.7 2.6e-49
CAA96549 Cor a 1.0301 160 728 178.7 6.6e-47
ABZ81046 Que a 1.0301 160 725 178.0 1.1e-46
CAA54696.1 Bet v 1.0301 160 709 174.3 1.4e-45
AFN42528 Can s 5.0101 161 709 174.3 1.4e-45
AUH28179 Que m 1.0101 160 703 172.9 3.8e-45
AAG40329 Cor a 1.0402 161 690 169.8 3.2e-44
AAD48405 Cor a 1.0401 161 689 169.6 3.7e-44
AAG40330 Cor a 1.0403 161 687 169.1 5.1e-44
Q39427 Bet v 1.0205 160 686 168.9 6e-44
AAG40331 Cor a 1.0404 161 686 168.9 6.1e-44
ABZ81047 Que a 1.0401 160 683 168.2 9.8e-44
P43186 Bet v 1.0204 160 681 167.7 1.4e-43
CAA04828.1 Bet v 1.0206 159 678 167.0 2.2e-43
CAA54481 Bet v 1.0202 160 669 164.9 9.5e-43
P43184 Bet v 1.0203 160 668 164.7 1.1e-42
CAA54421 Bet v 1.0201 160 665 164.0 1.8e-42
CAA96548 Cor a 1.0201 160 662 163.3 3e-42
QOL10866 Que ac 1.0101 159 658 162.3 5.6e-42
CAA07329.1 Bet v 1.0118 160 655 161.6 9.2e-42
CAB02160 Bet v 1.0113 160 653 161.2 1.3e-41
CAA50325 Cor a 1.0103 160 649 160.2 2.4e-41
Q0Z8U9 Rub i 1.0101 137 647 159.8 2.7e-41
ABZ81045 Que a 1.0201 159 648 160.0 2.8e-41
CAA33887 Bet v 1.0101 160 646 159.5 4e-41
CAB02159 Bet v 1.0112 160 646 159.5 4e-41
CAA54487 Bet v 1.0106 160 646 159.5 4e-41
CAA04827.1 Bet v 1.0116 159 645 159.3 4.6e-41
CAB02156 Bet v 1.0109 160 645 159.3 4.7e-41
CAA54483 Bet v 1.0103 160 645 159.3 4.7e-41
QGS84240 Que i 1.0101 159 644 159.1 5.4e-41
CAB02161 Bet v 1.0114 160 644 159.1 5.5e-41
CAA54484 Bet v 1.0104 160 641 158.4 8.9e-41
CAB02217 Car b 1.0302 161 639 157.9 1.2e-40
CAA50327 Cor a 1.0101 160 637 157.4 1.7e-40
AAB24432 Aln g 1 160 633 156.5 3.3e-40
CAA07323.1 Bet v 1.0117 160 633 156.5 3.3e-40
CAB02155 Bet v 1.0108 160 632 156.2 3.8e-40
CAA54485 Bet v 1.0105 160 632 156.2 3.8e-40
CAA54482 Bet v 1.0102 160 631 156.0 4.5e-40
CAA50328 Cor a 1.0102 160 631 156.0 4.5e-40
Q08407 Cor a 1 159 630 155.8 5.3e-40
CAB02157 Bet v 1.0110 160 630 155.8 5.3e-40
CAA96547 Bet v 1.0115 160 630 155.8 5.3e-40
CAB02207 Car b 1.0104 160 629 155.5 6.3e-40
P38948 Aln g 1 159 626 154.8 1e-39
CAA54489 Bet v 1.0107 160 626 154.8 1e-39
CAB02216 Car b 1.0301 161 626 154.8 1e-39
CAB02158 Bet v 1.0111 160 624 154.4 1.4e-39
CAB02206 Car b 1.0103 160 622 153.9 2e-39
ACF75030.1 Bet v 1.0207 150 621 153.7 2.1e-39
CAB02208 Car b 1.0105 160 619 153.2 3.2e-39
CAM31908 Act c 8.0101 159 613 151.8 8.3e-39
ABZ81042 Car b 1.0111 160 612 151.6 9.9e-39
ABZ81043 Car b 1.0112 160 612 151.6 9.9e-39
ADK39021 Ost c 1.0101 160 611 151.3 1.2e-38
ABZ81041 Car b 1.0110 160 611 151.3 1.2e-38
ABZ81040 Car b 1.0109 160 610 151.1 1.4e-38
CAB02209 Car b 1.0106 160 609 150.9 1.6e-38
ABZ81044 Car b 1.0113 160 608 150.6 1.9e-38
P38950 Car b 1 159 605 149.9 3.1e-38
CAA50326 Cor a 1.0104 160 605 149.9 3.1e-38
CAB02213 Car b 1.0107 160 599 148.5 8.2e-38
CAA47357 Car b 1.0102 159 594 147.4 1.8e-37
CAB02215 Car b 1.0108 160 589 146.2 4.1e-37
P38949 Car b 1 159 581 144.3 1.5e-36
ABC41615.1 Bet v 1.0119 150 573 142.5 5.1e-36
CAM31909 Act d 8.0101 157 555 138.2 1e-34
CAA42646 Gly m 4 158 542 135.2 8.4e-34
AHC08073 Sola l 4.0101 160 522 130.5 2.2e-32
NP_001275580 Sola l 4.0201 160 518 129.5 4.2e-32
CAA43637 Pha v 1 156 515 128.9 6.6e-32
P25985 Pha v 1 155 508 127.2 2e-31
CAA43636 Pha v 1 155 508 127.2 2e-31
AAQ91847 Ara h 8.0101 157 508 127.2 2.1e-31
CAA75803 Lyc e 4.0101 178 475 119.4 5.2e-29
Q2VU97 Vig r 1.0101 155 473 119.0 6e-29
EF436550 Ara h 8.0201 153 459 115.8 5.7e-28
CAA67246 Pet c PR10 155 438 110.8 1.8e-26
AAB92255 Tar o RAP 157 430 108.9 6.5e-26
AAL76932 Dau c 1.0201 154 413 105.0 1e-24
P92918 Api g 1.0201 159 412 104.7 1.2e-24
P49372 Api g 1 154 411 104.5 1.4e-24
Q5ULZ4 Fra a 1.0101 100 389 99.6 2.8e-23
CAB03716 Dau c 1.0104 154 384 98.2 1.1e-22
CAB06416 Dau c 1.0105 154 381 97.5 1.8e-22
BAA13604 Dau c 1.0102 154 378 96.8 3e-22
AAB01092 Dau c 1.0101 168 376 96.3 4.6e-22
CAB03715 Dau c 1.0103 154 371 95.1 9.2e-22
P85126 Que a 1.0101 50 223 61.0 5.6e-12
Q9ZWP8 Vig r 6.0101 155 176 49.5 5.2e-08
Q9S8Q4 Cas s 1 24 118 36.8 5.4e-05
P85524 Act d 11.0101 150 109 33.8 0.0026
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 252.5 bits 1043,  Expect = 4e-69
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 2. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 247.6 bits 1022,  Expect = 1e-67
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDSIDKEN+SYSYTLIEGDALGD LEKISYETKLVASPSGGSIIKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+VEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 3. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 224.2 bits 922,  Expect = 1e-60
 Identities = 139/159 87%, Positives = 152/159 95%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 224.2 bits 922,  Expect = 1e-60
 Identities = 139/159 87%, Positives = 152/159 95%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 5. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 223.2 bits 918,  Expect = 3e-60
 Identities = 138/159 86%, Positives = 152/159 95%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKL+AS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 6. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 223.0 bits 917,  Expect = 3e-60
 Identities = 138/159 86%, Positives = 151/159 94%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFK FVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 7. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 222.8 bits 916,  Expect = 4e-60
 Identities = 138/159 86%, Positives = 151/159 94%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 8. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 222.8 bits 916,  Expect = 4e-60
 Identities = 138/159 86%, Positives = 152/159 95%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE++LKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 9. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 222.3 bits 914,  Expect = 5e-60
 Identities = 138/159 86%, Positives = 151/159 94%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHV AGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 219.5 bits 902,  Expect = 3e-59
 Identities = 137/158 86%, Positives = 149/158 94%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GV+TYE+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            GSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SHY
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISHY 119
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            HTKGDVEI EEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 11. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 217.8 bits 895,  Expect = 1e-58
 Identities = 134/160 83%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQAIK +EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+YGYVKHKI SIDKENH+YSY+LIEGDAL DN+EKI YETKLV++P GG+IIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 12. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 217.4 bits 893,  Expect = 2e-58
 Identities = 132/160 82%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+YGYVKHKI SIDKENH+YSY+LIEGDAL DN+EKI YETKLV++P GG++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 13. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 216.0 bits 887,  Expect = 4e-58
 Identities = 133/159 83%, Positives = 149/159 93%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG++T+E+EFTSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEG+GGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH++DSID+ ++SY+YTLIEGDAL D +EKISYE KLVAS SG S IKS SH
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD+EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 14. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 215.7 bits 886,  Expect = 5e-58
 Identities = 133/160 83%, Positives = 148/160 92%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG +TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQAIK +EILEGDGGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+YGYVKHKI SIDKENH+YSY+LIEGDAL DN+EKI YETKLV++P GG+IIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 15. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 213.9 bits 878,  Expect = 2e-57
 Identities = 134/159 84%, Positives = 149/159 93%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 213.4 bits 876,  Expect = 2e-57
 Identities = 133/159 83%, Positives = 149/159 93%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 17. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 213.2 bits 875,  Expect = 3e-57
 Identities = 130/160 81%, Positives = 148/160 92%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+YGYVKHKI SIDK NH+YSY+LIEGDAL +N+EKI YETKLV++P GG+IIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKA++LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 18. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 212.9 bits 874,  Expect = 3e-57
 Identities = 132/159 83%, Positives = 148/159 93%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+YGYVKHKI SIDKENH+YSY+LIEGDAL DN+EKI YETKLV++P G +IIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 211.8 bits 869,  Expect = 7e-57
 Identities = 133/159 83%, Positives = 148/159 93%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 20. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 211.3 bits 867,  Expect = 1e-56
 Identities = 132/159 83%, Positives = 148/159 93%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVKAGK KA  LFKLIE+YLKGHPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 210.6 bits 864,  Expect = 2e-56
 Identities = 132/159 83%, Positives = 147/159 92%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVK GKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 210.3 bits 863,  Expect = 2e-56
 Identities = 132/159 83%, Positives = 147/159 92%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +E ISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 210.3 bits 863,  Expect = 2e-56
 Identities = 133/159 83%, Positives = 147/159 92%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 209.6 bits 860,  Expect = 3e-56
 Identities = 130/159 81%, Positives = 146/159 91%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG +I KS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YH KG++EIKEEHVK GKEK   LFKLIE+YLKGHPDAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 209.2 bits 858,  Expect = 4e-56
 Identities = 132/159 83%, Positives = 146/159 91%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG++EIKEEHVK GKEKA  LFKLIE+YLK HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 26. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 205.0 bits 840,  Expect = 8e-55
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP PRLFKAF+LD DNL+PKIAPQAIK +EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVK++++ IDK+N +YSY++IEGD L D LEKI+YETKL+ASP GGSIIK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 205.0 bits 840,  Expect = 8e-55
 Identities = 122/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+EFTS IP PRLFKAF+LD DNL+PKIAPQAIK ++I+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVK++++ IDK+N +YSY++IEGD L D LEKI+YETKL+ASP GGSIIK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 205.0 bits 840,  Expect = 8e-55
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+EFTS IP PRLFKAF+LD DNL+PKIAPQAIK +EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQYGYVK++++ IDK+N +YSY++IEGD L D LEKI+YETKL+ASP GGSIIK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            Y  KGDVEIKEEHVKAGKEKAS LFKL+E YL  H DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 204.7 bits 839,  Expect = 1e-54
 Identities = 123/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYE+EFTS IPP +LFKAF+LDADNL+PK+AP A+K +EILEGDGG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQY YVKH++D IDK+N SYSYTLIEGDAL D +E I+Y+ KLVASP GGSI+K+TSH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 30. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 204.0 bits 836,  Expect = 2e-54
 Identities = 129/159 81%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESEFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS Y YVKH+ID +DKEN  Y Y++IEGDA+ + +EKISYETKLVAS SG S+IKSTSH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 31. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 199.6 bits 817,  Expect = 3e-53
 Identities = 126/159 79%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESEFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS Y YVKH+ID +DK+N  Y Y++IEGDA+ + +EKISYETKLVA+ SG S+IKSTSH
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSG-SVIKSTSH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 32. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 198.4 bits 812,  Expect = 8e-53
 Identities = 125/159 78%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+EFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS Y YVKH+ID +DKEN  Y Y++IEGDA+ + +EKISYETKLVAS SG S+IKSTSH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTK DVEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 33. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 197.0 bits 806,  Expect = 2e-52
 Identities = 125/159 78%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYE EFTS IPP RL+ AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS Y YVKHKID +DK+N  Y Y++IEGDA+ + +EKISYETKLVAS SG S+IKS SH
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSG-SVIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 34. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 195.4 bits 799,  Expect = 6e-52
 Identities = 119/160 74%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYE+E TS IPP RLFKAFVLDADNL+PK+ PQA+K SEI+EG+GGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQY YVKH+ D+ID+ N +Y+Y++IEGDAL D +EKISYETK+VAS  GGSI+KS SH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +E YL  HPDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 35. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 193.2 bits 790,  Expect = 3e-51
 Identities = 118/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG+FTY  E TS IPPPRLFKA+VL+AD L+PKIAPQ++K +EI+EGDGG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+Y YVKH+ID +DK+N  Y+Y+L+EGDAL D +EKISYE KLVAS  GGS+IKSTS+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGDVEIKEE VKAGKEKA+ LFKLIE YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 36. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 187.9 bits 767,  Expect = 1e-49
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESE T+ I P RLFKAFVLDADNL+PK+APQAIK SEI+EG GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQ+ YVKH+ID ID  N +Y+ TLIEGDA+ + LEKI+YE KLVASP GGSI+KSTS 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 37. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 186.7 bits 762,  Expect = 3e-49
 Identities = 114/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFT+E+E TS IPP RLFKAFVLDADNL+PK+AP+AIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGSQ+ YVKH+ID ID+ N +Y Y++IEGD + + LEKISYE K+VASP GGSI+K+TS 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ EIKEE V AGKEKA+ LFK +E YL  H DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 178.7 bits 728,  Expect = 7e-47
 Identities = 108/160 67%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IPP RLFK FVLD+DNL+PK+AP+AIK  EI+EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + Y+K+K++ ID+ N SY Y++IEGDAL D LEKI+YE K+VASP GGSI+KS S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHT GD E+K+E++KAGKEKAS LFK +E YL  H DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 178.0 bits 725,  Expect = 1e-46
 Identities = 106/159 66%, Positives = 131/159 82%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESE  S IPP RLFKAFVLD+DNL+PK+ PQA+K +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+  + KH+ID ID EN +YS+++IEGDAL D LE +S ETK+VASP GGSI+KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 40. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 174.3 bits 709,  Expect = 1e-45
 Identities = 102/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E TS I P RLFK+FVLDADNL+PK+AP+ +  +E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS++ Y+KH++D ID  N  Y Y++IEG  LGD LEKISYE K+VA+P GGSI+K TS 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD+ + EE +KAGKEK + LFK +E YL  HP+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 41. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 174.3 bits 709,  Expect = 1e-45
 Identities = 105/160 65%, Positives = 135/160 84%, Gaps = 1/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFTYESEFTS I P RLFKAFVLD DNLVPKIAPQA++  EILEG+GG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDAL-GDNLEKISYETKLVASPSGGSIIKSTS 119
            +G  + YVKHKI++IDKE+ +YSY++IEGDAL G+ LEKI++E+KLVAS  GG++IK+ S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
             Y++ GD ++ EE VK G+++A+ ++K +E YLK HP+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 42. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 172.9 bits 703,  Expect = 4e-45
 Identities = 102/159 64%, Positives = 128/159 80%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV  YESE  S IPP RLFKAFVLD+DNL+PK+ PQA+K +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+  + KH+ID ID EN ++S+++IEGDAL D LE +S ETK+VASP GGSI+KST  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 43. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 169.8 bits 690,  Expect = 3e-44
 Identities = 103/159 64%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF+YE E TS IPP RLFK+FVLDADNL+PK+APQ    +E LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASP-SGGSIIKSTS 119
            EGS++ Y+KHK++ ID  N  Y Y++IEG  LG  LEKISYE K+ A+P  GGSI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
             YHTKG+  I EE +KAGKEKA+ LFK +E YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 44. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 169.6 bits 689,  Expect = 4e-44
 Identities = 103/159 64%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E TS IPP RLFK+FVLDADNL+PK+APQ    +E LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASP-SGGSIIKSTS 119
            EG+++ Y+KHK++ ID  N  Y Y++IEG  LG  LEKISYE K+ A+P  GGSI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
             YHTKG+  I EE +KAGKEKA+ LFK +E YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 169.1 bits 687,  Expect = 5e-44
 Identities = 103/159 64%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E TS IPP RLFK+FVLDADNL+PK+APQ    +E LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASP-SGGSIIKSTS 119
            EGS++ Y+KHK++ ID  N  Y Y++IEG  LG  LEKISYE K+ A+P  GGSI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
             YHTKG+  I EE +KAGKEKA+ LFK +E YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 168.9 bits 686,  Expect = 6e-44
 Identities = 102/160 63%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E KLVA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K EH+KA KEKA  L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 168.9 bits 686,  Expect = 6e-44
 Identities = 102/159 64%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF+YE E TS IPP RLFK+FVLDADNL+PK+APQ    +E LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASP-SGGSIIKSTS 119
            EG+++ Y+KHK++ ID  N  Y Y++IEG  LG  LEKI YE K+ A+P  GGSI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
             YHTKG+  I EE +KAGKEKA+ LFK +E YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 48. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 168.2 bits 683,  Expect = 1e-43
 Identities = 102/159 64%, Positives = 128/159 80%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+  + KH+ID ID EN +YS+++IEGDAL D LE +S ETK+VASP GGSI KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 167.7 bits 681,  Expect = 1e-43
 Identities = 101/160 63%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YESE TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 167.0 bits 678,  Expect = 2e-43
 Identities = 101/159 63%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YESE TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            GS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E KLVA+P GGSI+K ++ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            HTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 164.9 bits 669,  Expect = 9e-43
 Identities = 99/160 61%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YESE TS IP  RLFKAF+L+ D L+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 164.7 bits 668,  Expect = 1e-42
 Identities = 99/160 61%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YESE TS IP  RLFKAF+L+ D L+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 164.0 bits 665,  Expect = 2e-42
 Identities = 98/160 61%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+L+ D L+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 163.3 bits 662,  Expect = 3e-42
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD +NL+PK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK +++ +D  N  YSYT+IEG  +GD +EKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+  EH+K GKEK   LF+ +E YL  H DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 162.3 bits 658,  Expect = 6e-42
 Identities = 97/159 61%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV+ YES+ TS IPP RLFKAFVLD+DNL+ K+ P+A+K +EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E S+  Y KH+ID++D EN SYS+++IEG+AL D +  IS E K+VASP GGSI+KST+ 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HPD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 56. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 161.6 bits 655,  Expect = 9e-42
 Identities = 96/160 60%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E KLVA+P GGSI++ ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 161.2 bits 653,  Expect = 1e-41
 Identities = 96/160 60%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNLVPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 160.2 bits 649,  Expect = 2e-41
 Identities = 95/160 59%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+Y YVK ++D +D  N +YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 59. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 159.8 bits 647,  Expect = 3e-41
 Identities = 98/137 71%, Positives = 117/137 85%, Gaps = 1/137 0%
Query  10   FTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVK 69
            +TS IPPP+LFKAFVLDADNL+PKIAPQA+K  EI+EGDGG GT+KKI +GEG+++ YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEI 129
            HKID +DK N  YSY++ EGDALGD +EKISYE KLVAS   GSIIK+TSHYH KG  EI
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEI 119
Query  130  KEEHVKAGKEKASNLFKL 147
            KEE+VK GKE+A+ LFK+
Sbjct  120  KEEQVKDGKERAAGLFKI 137

Sequence Alignment: 60. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 160.0 bits 648,  Expect = 3e-41
 Identities = 97/158 61%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E S++ Y KH+ID++D EN +YS+++IEGDAL   +E +S E K VASP GGSI+KST+ 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 61. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 159.5 bits 646,  Expect = 4e-41
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 159.5 bits 646,  Expect = 4e-41
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GGSI+K ++ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 159.5 bits 646,  Expect = 4e-41
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  YSY++IEG  +GD LEKIS E K+VA+P+GGSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 159.3 bits 645,  Expect = 5e-41
 Identities = 96/159 60%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            G  + YVK ++D +D  N  YSY+LIEG  +GD LEKIS E K+VA+P GGSI+K ++ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            HTKGD E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 159.3 bits 645,  Expect = 5e-41
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 159.3 bits 645,  Expect = 5e-41
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  YSY++IEG  +GD LEKIS E K+VA+P+GGSI+K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 159.1 bits 644,  Expect = 5e-41
 Identities = 98/158 62%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV T+ES+ TS IPP RLFKAFVLD+DNL+PK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E S++ Y KH+ID++D EN +YS+++IEGDAL D +  +S E K+VASP GGSI KST+ 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            Y+TKGD ++KEE+++A  EK + L K +E YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 68. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 159.1 bits 644,  Expect = 5e-41
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 158.4 bits 641,  Expect = 9e-41
 Identities = 95/160 59%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  YSY++IEG  +GD LEKIS E K+VA+P+GGSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 157.9 bits 639,  Expect = 1e-40
 Identities = 94/160 58%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD +NL+PK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS   YVK +++ +D  N  YSYT+IEG  +GD +EKI  E K+VA+P GGSI+K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 71. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 157.4 bits 637,  Expect = 2e-40
 Identities = 94/160 58%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+Y YVK ++D +D  N +YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 72. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 156.5 bits 633,  Expect = 3e-40
 Identities = 92/160 57%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFKAF+LD D L+PK+AP+A+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + YVK ++D +D+ N  YS+++IEG A+GD LEK+  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +HTKGD EI  E++K  KEKA  L+K +E+YL  H DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 156.5 bits 633,  Expect = 3e-40
 Identities = 92/160 57%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 156.2 bits 632,  Expect = 4e-40
 Identities = 92/160 57%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 156.2 bits 632,  Expect = 4e-40
 Identities = 92/160 57%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YESE TS IP  RLFKAF+L+ DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 156.0 bits 631,  Expect = 5e-40
 Identities = 93/160 58%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E TS IP  RLFKAF+LD DNLVPK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 156.0 bits 631,  Expect = 5e-40
 Identities = 94/160 58%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+Y YVK ++D +D  N  YSYT+IEGD LGD LEK+  E K+VA+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 78. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 155.8 bits 630,  Expect = 5e-40
 Identities = 93/159 58%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            GS+Y YVK ++D +D  N +YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 79. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 155.8 bits 630,  Expect = 5e-40
 Identities = 92/160 57%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 80. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 155.8 bits 630,  Expect = 5e-40
 Identities = 93/160 58%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +  +N  YSY++IEG  +GD LEKIS E K+VA+P G SI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 81. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 155.5 bits 629,  Expect = 6e-40
 Identities = 90/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGDNLEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 82. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 154.8 bits 626,  Expect = 1e-39
 Identities = 91/159 57%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YE+E  S IP  RLFKAF+LD D L+PK+AP+A+   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            GS + YVK ++D +D+ N  YS+++IEG A+GD LEK+  E K+VA+P GGSI+K ++ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            HTKGD EI  E++K  KEKA  L+K +E+YL  H DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 83. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 154.8 bits 626,  Expect = 1e-39
 Identities = 91/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  R+FKAF+LD D LVPK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 154.8 bits 626,  Expect = 1e-39
 Identities = 92/160 57%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD + L+PK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS   YVK +++ +D  N  YSYT+IEG  +GD +EKI  E K+VA+P GGSI+K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 85. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 154.4 bits 624,  Expect = 1e-39
 Identities = 91/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
             G  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 86. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 153.9 bits 622,  Expect = 2e-39
 Identities = 89/160 55%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 87. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 153.7 bits 621,  Expect = 2e-39
 Identities = 92/149 61%, Positives = 115/149 77%, Gaps = 0/149 0%
Query  4    FTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGS 63
            F YESE TS IP  RLFKAF+L+ DNL+PK+APQAI   E +EG+GGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHT 123
             + YVK ++D +D  N  YSY++IEG ALGD LEKI  E K+VA+P GGSI+K ++ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            KGD E+K EH+KA KEK   L++ +E+YL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 88. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 153.2 bits 619,  Expect = 3e-39
 Identities = 89/160 55%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 89. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 151.8 bits 613,  Expect = 8e-39
 Identities = 90/157 57%, Positives = 121/157 77%, Gaps = 0/157 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV TY+ E  S++PP +L+KAF+LD D LVPK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS++  VK+++D+IDK+N +YSYT+IEGD L + +E ISY  K+VA P GGSI K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPD 157
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 151.6 bits 612,  Expect = 1e-38
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 151.6 bits 612,  Expect = 1e-38
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 151.3 bits 611,  Expect = 1e-38
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 151.3 bits 611,  Expect = 1e-38
 Identities = 87/160 54%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 151.1 bits 610,  Expect = 1e-38
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 150.9 bits 609,  Expect = 2e-38
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 150.6 bits 608,  Expect = 2e-38
 Identities = 88/160 55%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG  + +VK ++D +D  N  YSYT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 97. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 149.9 bits 605,  Expect = 3e-38
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YE+E TS IP  RLFKAF+LD + L+PK++PQA+   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            GS   YVK +++ ID  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            H KG  E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 98. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 149.9 bits 605,  Expect = 3e-38
 Identities = 91/160 56%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE E  S I   RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS+Y YVK ++D +D  N  YSYT+IEGD LGD LEK+  E K+VA+P GGS +K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 99. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 148.5 bits 599,  Expect = 8e-38
 Identities = 87/160 54%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  +SYT+IEGD LGD LEK+S E K+VA+P GGSI+K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 147.4 bits 594,  Expect = 2e-37
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            GS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            H KG  E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 146.2 bits 589,  Expect = 4e-37
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVF YE+E  S +P  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS + +VK ++D +D  N  +SYT+IEGD LGD LEK+S E  +VA+P GGSI+K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 144.3 bits 581,  Expect = 2e-36
 Identities = 84/159 52%, Positives = 111/159 69%, Gaps = 0/159 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVF YE+E  S IP  RLFK++VLD D L+PK+APQ I   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
            G  + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            H KG  E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 142.5 bits 573,  Expect = 5e-36
 Identities = 84/149 56%, Positives = 110/149 73%, Gaps = 0/149 0%
Query  4    FTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGS 63
            F YE+E TS IP  RLFKAF+LD DNL PK+APQAI   + +EG+GGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHT 123
             + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG I+K ++ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            KG+ E+K E+VKA KE    L++ +E+YL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 138.2 bits 555,  Expect = 1e-34
 Identities = 86/156 55%, Positives = 110/156 70%, Gaps = 1/156 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG  TY+ E  S I   ++FKAFVLD D ++PK  P+AI   + LEGDGG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EGS +  VKH+ID +DKEN +YSY++IEG AL D +E ISY  K+VA+P GG I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPD 157
            Y  K D ++ EE +KAGKE+AS +FK +E YL  +PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 135.2 bits 542,  Expect = 8e-34
 Identities = 87/158 55%, Positives = 111/158 70%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFT+E E  S + P  L+KA+V DADN++PK A  + K  E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E  +  +V HKI+SID+ N  YSY+++ G AL D  EKI++++KLVA P+GGS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160
            Y TKGD E  ++ +K GK KA  LFK IE YL  HPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 130.5 bits 522,  Expect = 2e-32
 Identities = 80/159 50%, Positives = 108/159 67%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV TY  E T+ I P RLFKA+VLD DNLVPK+  Q +K++E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG    Y+KHKI  ID +N    Y+LIEGD LG+ LE I+Y+ K+ A+ +GG + K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            YHTKGD  + EE    G+E+  N+ K +E YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 129.5 bits 518,  Expect = 4e-32
 Identities = 82/159 51%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV T+  E T+ I P RLFK +VLD D+LVPK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG    Y+KHKI  ID +N    Y+LIEGD LGD LE I+Y+ K+ A+  GG + K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            YHTKGD  + EE    GK KA +LFK IE YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 128.9 bits 515,  Expect = 7e-32
 Identities = 77/156 49%, Positives = 108/156 69%, Gaps = 0/156 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E  +  +V HKI+SID+ N  YSY+++ G AL +  EKI++++KL   P+GGS+IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156
            YH+KGD    E+ +KAGK K+ +LFK +E YL  +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 127.2 bits 508,  Expect = 2e-31
 Identities = 76/155 49%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
            GVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
              +  +V HKI+SID+ N  YSY+++ G AL +  EKI++++KL   P+GGS+IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156
            H+KGD    E+ +KAGK K+ +LFK +E YL  +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 127.2 bits 508,  Expect = 2e-31
 Identities = 79/155 50%, Positives = 108/155 69%, Gaps = 1/155 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            M VFT+E + TS + P  L+KA+V DAD +VPK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E  +  +V HKI+ ID+ N  YSY+++ G AL D  EKIS ++KL   P+GGS++K +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 127.2 bits 508,  Expect = 2e-31
 Identities = 79/157 50%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGVFT+E E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E  +  ++ HK++SID+ N++Y+Y+++ G AL    EKI++ETKLV  P+GGSI K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159
            YHTKGD +  EE +K GK K   LF+ IE Y+  +P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 119.4 bits 475,  Expect = 5e-29
 Identities = 73/146 50%, Positives = 99/146 67%, Gaps = 0/146 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV TY  E T+ I P RLFKA+VLD DNLVPK+  Q +K++E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            EG    Y+KHKI  ID +N    Y+LIEGD LG+ LE I+Y+ K+ A+ +GG + K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFK 146
            YHTKGD  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 119.0 bits 473,  Expect = 6e-29
 Identities = 74/155 47%, Positives = 104/155 67%, Gaps = 1/155 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            M VFT++ + TS + P  L+ A+  DADN++PK A  + +  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E  +  +V HKI+S+D+ N  YSY+++ G AL D  EKI+ +TK+     GGS+IK T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156
            YH KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 115.8 bits 459,  Expect = 6e-28
 Identities = 74/150 49%, Positives = 105/150 70%, Gaps = 2/150 1%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV T+E E TS +PP +LFKA V+D D L PK+ P AI+  EI+EG+GGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            E  +  YV HKID+ID+  ++Y YT+  G  + + LEK+S++TKL A+  GGS IK +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            +HTKGD  + +E  +  K+K+  +FK IE Y+
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYV 150

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 110.8 bits 438,  Expect = 2e-26
 Identities = 67/152 44%, Positives = 101/152 66%, Gaps = 0/152 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            + S Y  +K+KID+IDKE  ++SY++I+GD L   ++ I+    +V +  GG    ST+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152

Sequence Alignment: 116. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 108.9 bits 430,  Expect = 7e-26
 Identities = 66/152 43%, Positives = 93/152 61%, Gaps = 0/152 0%
Query  7    ESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYG 66
            E E TS + P  +FKAFV+D D + PK  P+  K  + +EGDGG GTIK IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGD 126
              KHK+D+ID  N S SYT+ EGD L   +E  ++  K++ S  GGS+ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  VEIKEEHVKAGKEKASNLFKLIETYLKGHPDA 158
             ++ +E+V   KE     FK IETY+  HP+A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 117. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 105.0 bits 413,  Expect = 1e-24
 Identities = 66/150 44%, Positives = 98/150 65%, Gaps = 3/150 2%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV   E E  S +   ++++ F+LD D + PK+ PQ IK  EILEGDGG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS-GGSIIKSTS 119
            E ++Y  +K+K+D IDK    Y+YT I GD L + LE +    ++V  P+ GG I+K+T+
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV--NQFVVVPTDGGCIVKNTT 118
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
             Y+TKGD  + E+ VK   EK++  FK +E YL
Sbjct  119  IYNTKGDAVLPEDKVKEATEKSALAFKAVEAYL 151

Sequence Alignment: 118. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 104.7 bits 412,  Expect = 1e-24
 Identities = 67/150 44%, Positives = 98/150 65%, Gaps = 3/150 2%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV     E  S +   ++++ F+LD D + PK+ PQ IK  EILEGDGG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS-GGSIIKSTS 119
            E ++Y  +K+K+D IDK   +Y+YT I GD L D LE +  E  +V  P+ GG I+K+T+
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNE--FVVVPTDGGCIVKNTT 118
Query  120  HYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
             Y+TKGD  + E+ +K   EK++  FK +E YL
Sbjct  119  IYNTKGDAVLPEDKIKEATEKSALAFKAVEAYL 151

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 104.5 bits 411,  Expect = 1e-24
 Identities = 65/151 43%, Positives = 98/151 64%, Gaps = 1/151 0%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MGV T+  E+TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
            +G     +  +ID ++KE  ++ Y++I+GD L   +E I     LV +  GGSI K+T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151

Sequence Alignment: 120. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 99.6 bits 389,  Expect = 3e-23
 Identities = 82/100 82%, Positives = 90/100 90%, Gaps = 39/100 39%
Query  22   AFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHS 81
            AFVLDADNL+PK                      KITFGEGSQYGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKA 141
                 +EGDAL D LEKI YETKLV++PS  +IIK+TS YHTKGDVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  SNLFKLIETYLKGHPDAYN 160
            ++LFKLIE YLK HP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 98.2 bits 384,  Expect = 1e-22
 Identities = 65/149 43%, Positives = 96/149 64%, Gaps = 5/149 3%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG  ++  E TS +   ++F   VLD D ++PK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
            EGS    +  + D+++KE  +Y  T+I+GD L   +E I  ET LV  P+  GGSI K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            + +HTKGD  + EE++K   E+ + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYL 151

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 97.5 bits 381,  Expect = 2e-22
 Identities = 65/149 43%, Positives = 95/149 63%, Gaps = 5/149 3%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG  ++  E TS +   ++F   VLD D ++PK AP A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
            EGS    +  + D+++KE  +Y  T+I+GD L   +E I  ET LV  P+  GGSI K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 123. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 96.8 bits 378,  Expect = 3e-22
 Identities = 63/149 42%, Positives = 96/149 64%, Gaps = 5/149 3%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG  ++  E TS +   ++F   VLD D ++PK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
            EGS    +  + D+++KE  +Y  T+I+GD L + +E I  ET +V  P+  GGSI K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 96.3 bits 376,  Expect = 5e-22
 Identities = 63/149 42%, Positives = 96/149 64%, Gaps = 5/149 3%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG  ++  E TS +   ++F   VLD D ++PK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
            EGS    +  + D+++KE  +Y  T+I+GD L + +E I  ET +V  P+  GGSI K+T
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 165

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 95.1 bits 371,  Expect = 9e-22
 Identities = 64/149 42%, Positives = 94/149 63%, Gaps = 5/149 3%
Query  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
            MG  ++  E TS +   ++F   VLD D ++PK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
            EGS    +  + D+++KE  SY  T+I+GD L   +E I  ET +V  P+  GGSI K+T
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 61.0 bits 223,  Expect = 6e-12
 Identities = 33/50 66%, Positives = 42/50 84%, Gaps = 0/50 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGP 51
            GVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 49.5 bits 176,  Expect = 5e-08
 Identities = 41/144 28%, Positives = 65/144 45%, Gaps = 7/144 4%
Query  4    FTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGS 63
            F  ++E++  +    L+  +  D   +VPK+ P+ +K  +++EGDGG GTI    F    
Sbjct  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
Query  64   QYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHT 123
               Y + +I   D+ +H     +IEG  L   L       KL       +++     Y  
Sbjct  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
Query  124  KGDVEIKEEHVKAGKEKASNLFKL--IETYL 152
              D+E   E V   K   S L  L  +E YL
Sbjct  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 36.8 bits 118,  Expect = 5e-05
 Identities = 19/24 79%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFTYESEFTSEIPPPRLFKAFVL 25
            GVFT+ES+ TS IPP RLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 129. Allergen Name: Act d 11.0101 Sequence ID: P85524

 Score = 33.8 bits 109,  Expect = 0.003
 Identities = 26/97 26%, Positives = 50/97 51%, Gaps = 4/97 4%
Query  30   LVPKIAPQAIKHSEILEGDGGP-GTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIE 88
            L+ +++P  I+  ++LEG+ G  G++    +    +    K  +++ID+E  S ++ ++E
Sbjct  30   LISEMSPVNIQGVDLLEGNWGTVGSVIFFKYTIDGKEKTAKDIVEAIDEETKSVTFKIVE 89
Query  89   GDALGDNLEKISYETKLVASPSGGSIIKSTSHYHT-KGDVE 128
            GD +   L K       V +    + +  T HY   K DVE
Sbjct  90   GDLM--ELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKEDVE 128

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.