The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY
HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK13027 Mal d 1.0302 159 1012 287.5 1.2e-79
AAO25113 Mal d 1.0304 159 994 282.5 3.7e-78
CAA96534 Mal d 1.0301 159 972 276.4 2.6e-76
AAK13028 Mal d 1.0303 159 971 276.1 3.1e-76
O24248 Pru av 1 160 821 234.4 1.2e-63
AAD26545 Mal d 1.0202 159 819 233.8 1.7e-63
AAB01362 Mal d 1.0201 159 819 233.8 1.7e-63
Q2I6V8 Pru p 1.0101 160 817 233.2 2.5e-63
AAD26548 Mal d 1.0204 159 815 232.7 3.7e-63
AAD13683 Mal d 1.0206 159 814 232.4 4.5e-63
CAD32318 Mal d 1.0208 158 813 232.1 5.4e-63
AAK13030 Mal d 1.0207 159 813 232.1 5.4e-63
AAD26547 Mal d 1.0203 159 813 232.1 5.4e-63
AAD29671 Mal d 1.0108 159 811 231.6 8e-63
AAD26558 Mal d 1.0205 159 811 231.6 8e-63
CAA58646 Mal d 1.0101 159 806 230.2 2.1e-62
AAD26546 Mal d 1.0103 159 806 230.2 2.1e-62
AAD26552 Mal d 1.0104 159 805 229.9 2.5e-62
AAD26553 Mal d 1.0105 159 805 229.9 2.5e-62
O65200 Pyr c 1 159 805 229.9 2.5e-62
AAD26554 Mal d 1.0106 159 805 229.9 2.5e-62
B6CQS9 Pru du 1.0101 160 804 229.6 3.1e-62
CAA96536 Mal d 1.0402 160 803 229.3 3.8e-62
CAA96537 Mal d 1.0403 160 803 229.3 3.8e-62
CAA96535 Mal d 1.0401 160 803 229.3 3.8e-62
AAK13029 Mal d 1.0109 159 800 228.5 6.7e-62
O50001 Pru ar 1 160 800 228.5 6.8e-62
AAD26555 Mal d 1.0107 159 795 227.1 1.8e-61
Q256S4 Fra a 1 159 787 224.9 8.2e-61
CAA88833 Mal d 1.0102 159 786 224.6 1e-60
APD76154 Jug r 5.0101 160 778 222.4 4.7e-60
Q3T923 Fra a 1 160 777 222.1 5.7e-60
Q256S7 Fra a 1 160 775 221.5 8.4e-60
Q256S2 Fra a 1 160 770 220.2 2.2e-59
Q256S6 Fra a 1 160 766 219.0 4.8e-59
CAD10374 Cas s 1 160 734 210.1 2.3e-56
ACJ23864 Fag s 1.0101 160 721 206.5 2.8e-55
CAA96549 Cor a 1.0301 160 701 201.0 1.3e-53
CAA54696.1 Bet v 1.0301 160 682 195.7 5.2e-52
Q0Z8U9 Rub i 1.0101 137 680 195.3 5.8e-52
ABZ81046 Que a 1.0301 160 667 191.5 9.4e-51
AAD48405 Cor a 1.0401 161 666 191.2 1.2e-50
AAG40329 Cor a 1.0402 161 663 190.4 2.1e-50
AAG40331 Cor a 1.0404 161 663 190.4 2.1e-50
AFN42528 Can s 5.0101 161 661 189.8 3e-50
AAG40330 Cor a 1.0403 161 660 189.5 3.7e-50
Q39427 Bet v 1.0205 160 647 185.9 4.5e-49
AUH28179 Que m 1.0101 160 643 184.8 9.6e-49
P43186 Bet v 1.0204 160 642 184.5 1.2e-48
CAA04828.1 Bet v 1.0206 159 638 183.4 2.5e-48
CAA07329.1 Bet v 1.0118 160 637 183.1 3.1e-48
CAA96548 Cor a 1.0201 160 637 183.1 3.1e-48
CAA54481 Bet v 1.0202 160 630 181.2 1.2e-47
P43184 Bet v 1.0203 160 629 180.9 1.4e-47
CAB02160 Bet v 1.0113 160 628 180.6 1.7e-47
CAA33887 Bet v 1.0101 160 627 180.4 2.1e-47
CAB02159 Bet v 1.0112 160 627 180.4 2.1e-47
CAA54421 Bet v 1.0201 160 626 180.1 2.6e-47
CAB02156 Bet v 1.0109 160 626 180.1 2.6e-47
CAB02161 Bet v 1.0114 160 625 179.8 3.1e-47
CAA54485 Bet v 1.0105 160 623 179.2 4.6e-47
CAA54487 Bet v 1.0106 160 623 179.2 4.6e-47
ABZ81047 Que a 1.0401 160 623 179.2 4.6e-47
CAA54483 Bet v 1.0103 160 622 179.0 5.5e-47
CAA54482 Bet v 1.0102 160 620 178.4 8.1e-47
CAA54484 Bet v 1.0104 160 618 177.9 1.2e-46
CAA07323.1 Bet v 1.0117 160 616 177.3 1.8e-46
CAA50325 Cor a 1.0103 160 616 177.3 1.8e-46
CAA96547 Bet v 1.0115 160 615 177.0 2.1e-46
CAB02155 Bet v 1.0108 160 615 177.0 2.1e-46
CAA54489 Bet v 1.0107 160 615 177.0 2.1e-46
CAA04827.1 Bet v 1.0116 159 613 176.5 3.1e-46
CAB02217 Car b 1.0302 161 613 176.5 3.2e-46
CAB02157 Bet v 1.0110 160 610 175.6 5.6e-46
AAB24432 Aln g 1 160 609 175.3 6.8e-46
CAB02158 Bet v 1.0111 160 607 174.8 1e-45
CAA50327 Cor a 1.0101 160 604 174.0 1.8e-45
P38948 Aln g 1 159 602 173.4 2.6e-45
CAB02216 Car b 1.0301 161 600 172.8 3.9e-45
QOL10866 Que ac 1.0101 159 599 172.6 4.6e-45
Q08407 Cor a 1 159 597 172.0 6.8e-45
CAB02207 Car b 1.0104 160 597 172.0 6.9e-45
CAA50328 Cor a 1.0102 160 597 172.0 6.9e-45
CAB02206 Car b 1.0103 160 596 171.7 8.3e-45
ABZ81045 Que a 1.0201 159 595 171.5 1e-44
QGS84240 Que i 1.0101 159 595 171.5 1e-44
CAB02208 Car b 1.0105 160 593 170.9 1.5e-44
ABZ81041 Car b 1.0110 160 587 169.2 4.7e-44
ABZ81043 Car b 1.0112 160 586 168.9 5.7e-44
ABZ81042 Car b 1.0111 160 586 168.9 5.7e-44
ABZ81040 Car b 1.0109 160 584 168.4 8.5e-44
CAB02209 Car b 1.0106 160 583 168.1 1e-43
P38950 Car b 1 159 580 167.3 1.8e-43
ACF75030.1 Bet v 1.0207 150 579 167.1 2e-43
ADK39021 Ost c 1.0101 160 579 167.0 2.2e-43
ABZ81044 Car b 1.0113 160 578 166.7 2.7e-43
CAA50326 Cor a 1.0104 160 573 165.3 7.1e-43
CAM31908 Act c 8.0101 159 570 164.5 1.2e-42
CAB02213 Car b 1.0107 160 569 164.2 1.5e-42
CAA47357 Car b 1.0102 159 568 163.9 1.8e-42
ABC41615.1 Bet v 1.0119 150 559 161.5 9.4e-42
CAB02215 Car b 1.0108 160 559 161.4 1.1e-41
P38949 Car b 1 159 555 160.3 2.2e-41
CAM31909 Act d 8.0101 157 528 152.8 4e-39
NP_001275580 Sola l 4.0201 160 507 147.0 2.4e-37
AHC08073 Sola l 4.0101 160 490 142.2 6.3e-36
CAA42646 Gly m 4 158 483 140.3 2.4e-35
AAQ91847 Ara h 8.0101 157 476 138.4 9.1e-35
CAA43637 Pha v 1 156 467 135.9 5.1e-34
P25985 Pha v 1 155 460 133.9 2e-33
EF436550 Ara h 8.0201 153 455 132.5 5e-33
CAA43636 Pha v 1 155 454 132.2 6.2e-33
CAA75803 Lyc e 4.0101 178 454 132.1 8e-33
Q2VU97 Vig r 1.0101 155 448 130.6 2e-32
CAA67246 Pet c PR10 155 431 125.8 5.3e-31
AAL76932 Dau c 1.0201 154 421 123.1 3.6e-30
P92918 Api g 1.0201 159 420 122.8 4.6e-30
P49372 Api g 1 154 404 118.3 9.5e-29
AAB92255 Tar o RAP 157 404 118.3 9.9e-29
BAA13604 Dau c 1.0102 154 379 111.4 1.2e-26
CAB03716 Dau c 1.0104 154 379 111.4 1.2e-26
CAB06416 Dau c 1.0105 154 376 110.5 2.1e-26
AAB01092 Dau c 1.0101 168 376 110.4 2.5e-26
CAB03715 Dau c 1.0103 154 361 106.4 3.8e-25
Q5ULZ4 Fra a 1.0101 100 354 104.9 6.9e-25
P85126 Que a 1.0101 50 225 69.8 1.3e-14
Q9ZWP8 Vig r 6.0101 155 175 54.6 1.5e-09
Q9S8Q4 Cas s 1 24 126 43.0 7e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 287.5 bits 1012,  Expect = 1e-79
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 2. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 282.5 bits 994,  Expect = 4e-78
 Identities = 156/159 98%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDK+NFVYKYSVIEGDAISETIEKISYETKLVA+GSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEH DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 3. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 276.4 bits 972,  Expect = 3e-76
 Identities = 152/159 95%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDK+NFVYKYSVIEGDAISETIEKISYETKLVA+GSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIENYLL H DAYN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 276.1 bits 971,  Expect = 3e-76
 Identities = 151/159 94%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYE EFTSVIPPARL+NAFVLDADNLIPKIAPQAVKS EILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGSTYSYVKH+IDGVDKDNFVY+YSVIEGDAISETIEKISYETKLVA+GSGSVIKS SHY
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEH+DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 5. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 234.4 bits 821,  Expect = 1e-63
 Identities = 126/159 79%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSG-SVIKSTSH 119
            EGS Y YVKH+ID +DK+N+ Y Y++IEGDA+ +T+EKISYETKLVA+ SG S+IKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+VEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 6. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 233.8 bits 819,  Expect = 2e-63
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 7. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 233.8 bits 819,  Expect = 2e-63
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 8. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 233.2 bits 817,  Expect = 3e-63
 Identities = 126/159 79%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSG-SVIKSTSH 119
            EGS Y YVKH+ID +DK+N  Y Y++IEGDA+ + +EKISYETKLVA+ SG S+IKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 9. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 232.7 bits 815,  Expect = 4e-63
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKL+A+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 232.4 bits 814,  Expect = 4e-63
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF  FVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 232.1 bits 813,  Expect = 5e-63
 Identities = 123/158 77%, Positives = 140/158 88%, Gaps = 0/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GV+TYE+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHYH 121
            GS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHYH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            TKGDVEI EEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 12. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 232.1 bits 813,  Expect = 5e-63
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GT KKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 232.1 bits 813,  Expect = 5e-63
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE++L  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 231.6 bits 811,  Expect = 8e-63
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 231.6 bits 811,  Expect = 8e-63
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 230.2 bits 806,  Expect = 2e-62
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVK GKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 230.2 bits 806,  Expect = 2e-62
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 229.9 bits 805,  Expect = 3e-62
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 229.9 bits 805,  Expect = 3e-62
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 20. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 229.9 bits 805,  Expect = 3e-62
 Identities = 120/159 75%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG++T+E+EFTS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHR+D +D+ ++ Y Y++IEGDA+++TIEKISYE KLVA+GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGD+EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 229.9 bits 805,  Expect = 3e-62
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIE ISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 22. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 229.6 bits 804,  Expect = 3e-62
 Identities = 126/159 79%, Positives = 143/159 89%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG+FTY  E TSVIPP RLF A+VL+AD LIPKIAPQ+VKSAEI+EGDGGVGTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA-AGSGSVIKSTSH 119
            EGS YSYVKH+IDG+DKDNFVY YS++EGDA+S+ +EKISYE KLVA A  GSVIKSTS+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEE VKAGKEKA+ LFKLIENYL+ + DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 23. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 229.3 bits 803,  Expect = 4e-62
 Identities = 118/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIP  RLF AF+LD DNLIPKIAPQA+KS +I+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DKDNF Y YS+IEGD +S+ +EKI+YETKL+A+   GS+IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 229.3 bits 803,  Expect = 4e-62
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DKDNF Y YS+IEGD +S+ +EKI+YETKL+A+   GS+IK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            Y  KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 229.3 bits 803,  Expect = 4e-62
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DKDNF Y YS+IEGD +S+ +EKI+YETKL+A+   GS+IK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 228.5 bits 800,  Expect = 7e-62
 Identities = 121/159 76%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVK GKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 27. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 228.5 bits 800,  Expect = 7e-62
 Identities = 118/159 74%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYE+EFTSVIPP +LF AF+LDADNLIPK+AP AVK  EILEGDGGVGTIKK+ FG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y+YVKHR+DG+DKDN+ Y Y++IEGDA+S+ IE I+Y+ KLVA+   GS++K+TSH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YLL + DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 28. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 227.1 bits 795,  Expect = 2e-61
 Identities = 120/159 75%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKG++EIKEEHVKAGK KA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 29. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 224.9 bits 787,  Expect = 8e-61
 Identities = 121/159 76%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKH+I  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV+A  G++IK+TS Y
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 224.6 bits 786,  Expect = 1e-60
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSG+ IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            H KG++EIKEEHVK GKEK   LFKLIE+YL  H DAYN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 31. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 222.4 bits 778,  Expect = 5e-60
 Identities = 120/159 75%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYE+E TSVIPPARLF AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
            EGS Y YVKHR D +D+ NF Y YSVIEGDA+++ IEKISYETK+VA+   GS++KS SH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YH+KGD EIKEE VK GKEKAS LFK +E YLL H DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 32. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 222.1 bits 777,  Expect = 6e-60
 Identities = 122/159 76%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
            EGS Y YVKH+I  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV+A   G+VIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 33. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 221.5 bits 775,  Expect = 8e-60
 Identities = 120/159 75%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
            EGS Y YVKH+I  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV+A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 220.2 bits 770,  Expect = 2e-59
 Identities = 121/159 76%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
            EGS Y YVKH+I  +DK N  Y YS+IEGDA+SE IEKI YETKLV+A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEEHVKAGKEKA+HLFKLIE YL +H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 35. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 219.0 bits 766,  Expect = 5e-59
 Identities = 119/159 74%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG +TYE+EFTS IP  +LF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
            EGS Y YVKH+I  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV+A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 210.1 bits 734,  Expect = 2e-56
 Identities = 112/159 70%, Positives = 133/159 83%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E+E TS IPP RLF AFVLDADNLIPK+AP+A+KSAEI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVKHRID +D+ NF Y YSVIEGD ++E +EKISYE K+VA+   GS++K+TS 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ EIKEE V AGKEKA+ LFK +E YLL H DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 206.5 bits 721,  Expect = 3e-55
 Identities = 112/159 70%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESE T+VI PARLF AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS ++YVKHRID +D  NF Y  ++IEGDAISET+EKI+YE KLVA+   GS++KSTS 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD EIKE+++KAGKE+AS +FK +E YLL +  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 201.0 bits 701,  Expect = 1e-53
 Identities = 104/159 65%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIPPARLF  FVLD+DNLIPK+AP+A+KS EI+EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
            EGS ++Y+K++++ +D+ NF Y+YSVIEGDA+S+ +EKI+YE K+VA+   GS++KS S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHT GD E+K+E++KAGKEKAS LFK +E YLL H DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 195.7 bits 682,  Expect = 5e-52
 Identities = 103/159 64%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVI PARLF +FVLDADNLIPK+AP+ V SAE +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + Y+KHR+D +D  NF Y YS+IEG  + +T+EKISYE K+VAA G GS++K TS 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD+ + EE +KAGKEK + LFK +ENYL+ H +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 40. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 195.3 bits 680,  Expect = 6e-52
 Identities = 101/137 73%, Positives = 121/137 88%, Gaps = 0/137 0%
Query  10   FTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVK 69
            +TSVIPP +LF AFVLDADNLIPKIAPQAVKS EI+EGDGGVGT+KKI++GEG+ +SYVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHYHTKGDVEIK 129
            H+IDG+DK NFVY YS+ EGDA+ + IEKISYE KLVA+G GS+IK+TSHYH KG  EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVKAGKEKASHLFKL 146
            EE+VK GKE+A+ LFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 41. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 191.5 bits 667,  Expect = 9e-51
 Identities = 100/158 63%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESE  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS   + KHRID +D +NF Y +SVIEGDA+ + +E +S ETK+VA+   GS++KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ H D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 42. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 191.2 bits 666,  Expect = 1e-50
 Identities = 102/158 64%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIPPARLF +FVLDADNLIPK+APQ   SAE LEG+GG GTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA--GSGSVIKSTS 118
            EG+ + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ AA  G GS++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL H DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 190.4 bits 663,  Expect = 2e-50
 Identities = 101/158 63%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF+YE E TSVIPPARLF +FVLDADNLIPK+APQ    AE LEG+GG GTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA--GSGSVIKSTS 118
            EGS + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ AA  G GS++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL H D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 44. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 190.4 bits 663,  Expect = 2e-50
 Identities = 101/158 63%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF+YE E TSVIPPARLF +FVLDADNLIPK+APQ   SAE LEG+GG GTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA--GSGSVIKSTS 118
            EG+ + Y+KH+++ +D  NF Y YS+IEG  +  T+EKI YE K+ AA  G GS++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL H DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 45. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 189.8 bits 661,  Expect = 3e-50
 Identities = 97/159 61%, Positives = 131/159 82%, Gaps = 2/159 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTS I PARLF AFVLD DNL+PKIAPQAV+  EILEG+GGVGTIKKI FG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAI-SETIEKISYETKLVAAGSG-SVIKSTS 118
            +G  + YVKH+I+ +DK+++ Y YS+IEGDA+    +EKI++E+KLVA+G G +VIK+ S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
             Y++ GD ++ EE VK G+++A++++K +E YL +H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 46. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 189.5 bits 660,  Expect = 4e-50
 Identities = 101/158 63%, Positives = 120/158 75%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIPPARLF +FVLDADNLIPK+APQ    AE LEG+GG GTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA--GSGSVIKSTS 118
            EGS + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ AA  G GS++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL H D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 185.9 bits 647,  Expect = 4e-49
 Identities = 100/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E KLVA    GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K EH+KA KEKA  L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 184.8 bits 643,  Expect = 1e-48
 Identities = 96/158 60%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  YESE  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS   + KHRID +D +NF + +SVIEGDA+ + +E +S ETK+VA+   GS++KST  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ H D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 184.5 bits 642,  Expect = 1e-48
 Identities = 99/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA    GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 183.4 bits 638,  Expect = 3e-48
 Identities = 99/158 62%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YESE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            GS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E KLVA    GS++K ++ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 183.1 bits 637,  Expect = 3e-48
 Identities = 99/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E KLVA    GS+++ ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 183.1 bits 637,  Expect = 3e-48
 Identities = 96/159 60%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD +NLIPK+APQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VAA   GS++K ++ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+  EH+K GKEK   LF+ +E YLL H DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 181.2 bits 630,  Expect = 1e-47
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA    GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 180.9 bits 629,  Expect = 1e-47
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA    GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 180.6 bits 628,  Expect = 2e-47
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 180.4 bits 627,  Expect = 2e-47
 Identities = 97/159 61%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA    GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 180.4 bits 627,  Expect = 2e-47
 Identities = 97/159 61%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA    GS++K ++ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 180.1 bits 626,  Expect = 3e-47
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA    GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 180.1 bits 626,  Expect = 3e-47
 Identities = 96/159 60%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 179.8 bits 625,  Expect = 3e-47
 Identities = 97/159 61%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA    GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 179.2 bits 623,  Expect = 5e-47
 Identities = 97/159 61%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+L+ DNLIPK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA   G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 179.2 bits 623,  Expect = 5e-47
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    GS++K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 179.2 bits 623,  Expect = 5e-47
 Identities = 95/158 60%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS   + KHRID +D +NF Y +SVIEGDA+ + +E +S ETK+VA+   GS+ KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ H D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 64. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 179.0 bits 622,  Expect = 6e-47
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    GS++K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 178.4 bits 620,  Expect = 8e-47
 Identities = 96/159 60%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA   G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 177.9 bits 618,  Expect = 1e-46
 Identities = 95/159 59%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    GS++K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 177.3 bits 616,  Expect = 2e-46
 Identities = 96/159 60%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA   G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 177.3 bits 616,  Expect = 2e-46
 Identities = 92/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VAA G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 177.0 bits 615,  Expect = 2e-46
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSG-SVIKSTSH 119
            EG  + YVK R+D V   NF Y YSVIEG  I +T+EKIS E K+VA   G S++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 177.0 bits 615,  Expect = 2e-46
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA   G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 177.0 bits 615,  Expect = 2e-46
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP AR+F AF+LD D L+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA   G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 176.5 bits 613,  Expect = 3e-46
 Identities = 94/158 59%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            G  + YVK R+D VD  NF Y YS+IEG  + +T+EKIS E K+VA    GS++K ++ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 73. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 176.5 bits 613,  Expect = 3e-46
 Identities = 95/159 59%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD +NLIPK+APQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VAA   GS++K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 74. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 175.6 bits 610,  Expect = 6e-46
 Identities = 95/159 59%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I + +EKIS E K+VA   G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 175.3 bits 609,  Expect = 7e-46
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF AF+LD D L+PK+AP+AV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + YVK R+D VD+ NF Y +SVIEG A+ + +EK+  E K+VAA   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +HTKGD EI  E++K  KEKA  L+K +E+YLL H DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 174.8 bits 607,  Expect = 1e-45
 Identities = 95/159 59%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
             G  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA   G  V+K ++ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 174.0 bits 604,  Expect = 2e-45
 Identities = 91/159 57%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VAA G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 78. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 173.4 bits 602,  Expect = 3e-45
 Identities = 92/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E  SVIP ARLF AF+LD D L+PK+AP+AV S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            GS + YVK R+D VD+ NF Y +SVIEG A+ + +EK+  E K+VAA   GS++K ++ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            HTKGD EI  E++K  KEKA  L+K +E+YLL H DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 79. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 172.8 bits 600,  Expect = 4e-45
 Identities = 93/159 58%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VAA   GS++K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 80. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 172.6 bits 599,  Expect = 5e-45
 Identities = 94/158 59%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ YES+ TSVIPPARLF AFVLD+DNLI K+ P+AVKS EI+EG+GG GTIKK  FG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            E S   Y KHRID +D +N  Y +SVIEG+A+++ I  IS E K+VA+   GS++KST+ 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YLL H D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 81. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 172.0 bits 597,  Expect = 7e-45
 Identities = 90/158 56%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            GS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VAA G GS++K +S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 82. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 172.0 bits 597,  Expect = 7e-45
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 83. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 172.0 bits 597,  Expect = 7e-45
 Identities = 91/159 57%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VAA G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 171.7 bits 596,  Expect = 8e-45
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 171.5 bits 595,  Expect = 1e-44
 Identities = 92/157 58%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            E S + Y KHRID +D +N  Y +SVIEGDA++  +E +S E K VA+   GS++KST+ 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL+ H D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 86. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 171.5 bits 595,  Expect = 1e-44
 Identities = 93/157 59%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+ES+ TSVIPPARLF AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            E S + Y KHRID +D +N  Y +SVIEGDA+++ +  +S E K+VA+   GS+ KST+ 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            Y+TKGD ++KEE+++A  EK + L K +E YLL H D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 87. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 170.9 bits 593,  Expect = 1e-44
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 88. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 169.2 bits 587,  Expect = 5e-44
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GSV+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 89. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 168.9 bits 586,  Expect = 6e-44
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 168.9 bits 586,  Expect = 6e-44
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 168.4 bits 584,  Expect = 8e-44
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 168.1 bits 583,  Expect = 1e-43
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 167.3 bits 580,  Expect = 2e-43
 Identities = 87/158 55%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            GS   YVK R++ +D  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            H KG  E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 94. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 167.1 bits 579,  Expect = 2e-43
 Identities = 90/149 60%, Positives = 113/149 75%, Gaps = 1/149 0%
Query  4    FTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            F YESE TSVIP ARLF AF+L+ DNLIPK+APQA+ S E +EG+GG GTIKKI F EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   TYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHYHT 122
             + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA    GS++K ++ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            KGD E+K EH+KA KEK   L++ +E+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 95. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 167.0 bits 579,  Expect = 2e-43
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 166.7 bits 578,  Expect = 3e-43
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EG  + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 97. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 165.3 bits 573,  Expect = 7e-43
 Identities = 89/159 55%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E  SVI  ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VAA G GS +K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 98. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 164.5 bits 570,  Expect = 1e-42
 Identities = 82/156 52%, Positives = 113/156 72%, Gaps = 1/156 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV TY+ E  S +PP +L+ AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS +  VK+R+D +DKDN+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQD 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YLL + D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 99. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 164.2 bits 569,  Expect = 2e-42
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E K+VAA G GS++K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 163.9 bits 568,  Expect = 2e-42
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            GS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            H KG  E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 161.5 bits 559,  Expect = 9e-42
 Identities = 86/149 57%, Positives = 110/149 73%, Gaps = 1/149 0%
Query  4    FTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            F YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S + +EG+GG GTIKKINF EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   TYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSHYHT 122
             + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA   G  ++K ++ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            KG+ E+K E+VKA KE    L++ +E+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 102. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 161.4 bits 559,  Expect = 1e-41
 Identities = 83/159 52%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SV+P ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E  +VAA G GS++K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 103. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 160.3 bits 555,  Expect = 2e-41
 Identities = 83/158 52%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E  SVIP ARLF ++VLD D LIPK+APQ + S E + G+GG GTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
            G  + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            H KG  E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 152.8 bits 528,  Expect = 4e-39
 Identities = 83/155 53%, Positives = 105/155 67%, Gaps = 2/155 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  TY+ E  S I   ++F AFVLD D +IPK  P+A+   + LEGDGGVGTIK   FG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVI-KSTSH 119
            EGS +  VKHRIDG+DK+NF Y YS+IEG A+ +  E ISY  K+VA   G  I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQD 156
            Y  K D ++ EE +KAGKE+AS +FK +E YLL + D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 105. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 147.0 bits 507,  Expect = 2e-37
 Identities = 80/158 50%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+  E T+ I P RLF  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVI-KSTSH 119
            EG    Y+KH+I  +D  N+V KYS+IEGD + + +E I+Y+ K+ AAG G  + K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            YHTKGD  + EE    GK KA  LFK IE YLL +   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 142.2 bits 490,  Expect = 6e-36
 Identities = 77/158 48%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV TY  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG    Y+KH+I  +D  N+  KYS+IEGD + E +E I+Y+ K+ A  +G  V K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            YHTKGD  + EE    G+E+  ++ K +E YLL +   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 140.3 bits 483,  Expect = 2e-35
 Identities = 82/157 52%, Positives = 106/157 67%, Gaps = 3/157 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E E  S + PA L+ A+V DADN+IPK A  + KS E +EG+GG GTIKKI F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YSV+ G A+ +T EKI++++KLVA    GS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159
            Y TKGD E  ++ +K GK KA  LFK IE YLL H D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 138.4 bits 476,  Expect = 9e-35
 Identities = 77/156 49%, Positives = 105/156 67%, Gaps = 3/156 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E E TS +PPA+L+NA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
            E     ++ H+++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158
            YHTKGD +  EE +K GK K   LF+ IE Y+L +   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 135.9 bits 467,  Expect = 5e-34
 Identities = 73/152 48%, Positives = 102/152 67%, Gaps = 1/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            YH+KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLL 153

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 133.9 bits 460,  Expect = 2e-33
 Identities = 72/151 47%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSHY 120
                 +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            H+KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLL 152

Sequence Alignment: 111. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 132.5 bits 455,  Expect = 5e-33
 Identities = 71/151 47%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+E E TS +PPA+LF A V+D D L PK+ P A++S EI+EG+GG GT+KK+   
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            E    SYV H+ID +D+  + Y Y++  G    E +EK+S++TKL AA  GS IK +  +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            HTKGD  + +E  +  K+K+  +FK IE Y+L
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVL 151

Sequence Alignment: 112. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 132.2 bits 454,  Expect = 6e-33
 Identities = 74/151 49%, Positives = 104/151 68%, Gaps = 2/151 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            M VFT+E + TS + PA L+ A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            YH+KGD    E+ +KAGK K+  LFK+IE YLL
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLL 152

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 132.1 bits 454,  Expect = 8e-33
 Identities = 71/145 48%, Positives = 97/145 66%, Gaps = 1/145 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV TY  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
            EG    Y+KH+I  +D  N+  KYS+IEGD + E +E I+Y+ K+ A  +G  V K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFK 145
            YHTKGD  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 114. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 130.6 bits 448,  Expect = 2e-32
 Identities = 75/151 49%, Positives = 104/151 68%, Gaps = 2/151 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            M VFT++ + TS + PA L+NA+  DADN+IPK A  + +S EI+EG+GG GTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
            E     +V H+I+ VD+ N+ Y YS++ G A+ +T EKI+ +TK+   A  GS+IK T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            YH KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLL 152

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 125.8 bits 431,  Expect = 5e-31
 Identities = 65/152 42%, Positives = 99/152 65%, Gaps = 1/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV   E   TS +P A+LF A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
            + S Y  +K++ID +DK+ F + YS+I+GD +   I+ I+    +V  A  G    ST+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            ++TKGD  + EE++K   ++ + +FK +E YLL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLL 153

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 123.1 bits 421,  Expect = 4e-30
 Identities = 61/152 40%, Positives = 98/152 64%, Gaps = 0/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV   E E  S +   +++  F+LD D + PK+ PQ +KS EILEGDGGVGT++ +++G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            E + Y+ +K+++D +DK  + Y Y+ I GD + E +E +  +  +V    G ++K+T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            +TKGD  + E+ VK   EK++  FK +E YLL
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYLL 152

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 122.8 bits 420,  Expect = 5e-30
 Identities = 60/152 39%, Positives = 97/152 63%, Gaps = 0/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV     E  S +   +++  F+LD D + PK+ PQ +KS EILEGDGGVGT+K +++G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
            E + Y+ +K+++D +DK  + Y Y+ I GD + + +E +  E  +V    G ++K+T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            +TKGD  + E+ +K   EK++  FK +E YLL
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYLL 152

Sequence Alignment: 118. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 118.3 bits 404,  Expect = 1e-28
 Identities = 67/151 44%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+  E+TS +   ++F  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
            +G   + +  RIDGV+K+ + + YSVI+GD +   IE I     LV  A  GS+ K+T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            +HTKGD  + EE++K   E+ + LFK +E YL+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLI 152

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 118.3 bits 404,  Expect = 1e-28
 Identities = 60/151 39%, Positives = 93/151 61%, Gaps = 1/151 0%
Query  7    ESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYS 66
            E E TS + P+ +F AFV+D D + PK  P+  KS + +EGDGGVGTIK I + +G  ++
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSHYHTKGD 125
              KH++D +D +NF   Y++ EGD +   IE  ++  K++ +A  GSV K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  VEIKEEHVKAGKEKASHLFKLIENYLLEHQDA 157
             ++ +E+V   KE     FK IE Y++ H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 111.4 bits 379,  Expect = 1e-26
 Identities = 64/149 42%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
            EGS  + +  R D V+K+ + Y  +VI+GD + E IE I  ET +V    A  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 111.4 bits 379,  Expect = 1e-26
 Identities = 65/149 43%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
            EGS  + +  R D V+K+ + Y  +VI+GD +   IE I  ET LV    A  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K   E+ + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYLI 152

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 110.5 bits 376,  Expect = 2e-26
 Identities = 65/149 43%, Positives = 95/149 63%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS E+ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
            EGS  + +  R D V+K+ + Y  +VI+GD +   IE I  ET LV    A  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 110.4 bits 376,  Expect = 2e-26
 Identities = 64/149 42%, Positives = 95/149 63%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
            EGS  + +  R D V+K+ + Y  +VI+GD + E IE I  ET +V    A  GS+ K+T
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 166

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 106.4 bits 361,  Expect = 4e-25
 Identities = 63/149 42%, Positives = 94/149 63%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
            EGS  + +  R D V+K+ + Y  +VI+GD +   IE I  ET +V    A  GS+ K+T
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 104.9 bits 354,  Expect = 7e-25
 Identities = 78/99 78%, Positives = 87/99 87%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKDNFV 81
            AFVLDADNLIPK                      KI FGEGS Y YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSHYHTKGDVEIKEEHVKAGKEKA 140
                 +EGDA+S+T+EKI YETKLV+A S S +IK+TS YHTKGDVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  SHLFKLIENYLLEHQDAYN 159
            +HLFKLIE YL +H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 69.8 bits 225,  Expect = 1e-14
 Identities = 34/49 69%, Positives = 42/49 85%, Gaps = 0/49 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG 50
            GVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 54.6 bits 175,  Expect = 1e-09
 Identities = 40/126 31%, Positives = 64/126 50%, Gaps = 6/126 4%
Query  24   VLDAD--NLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKDNFV 81
            VL  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    + SY +  I   D+ +  
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YKYSVIEGDAISETIE--KISYETKLVAAGSGSVIKSTSHYHTKGDVEIKEEHVKAGKEK 139
                VIEG  +++ +   K +++   +      V    S+ H   D+E K    K  +  
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
Query  140  ASHLFKLIENYL 151
              +L +L E YL
Sbjct  140  LMYLRRL-ERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 43.0 bits 126,  Expect = 7e-07
 Identities = 20/24 83%, Positives = 22/24 91%, Gaps = 0/24 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVL 25
            GVFT+ES+ TSVIPPARLF AFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.