The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG
EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK
YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH
Sequence Info Allergen Name Length Opt Bits Score E Value
ACJ23864 Fag s 1.0101 160 1015 286.1 3e-79
CAD10374 Cas s 1 160 812 230.3 2e-62
APD76154 Jug r 5.0101 160 809 229.4 3.6e-62
O50001 Pru ar 1 160 786 223.1 2.9e-60
CAA96549 Cor a 1.0301 160 781 221.7 7.5e-60
O24248 Pru av 1 160 771 219.0 5.1e-59
Q2I6V8 Pru p 1.0101 160 767 217.9 1.1e-58
CAA96535 Mal d 1.0401 160 751 213.5 2.3e-57
CAA54696.1 Bet v 1.0301 160 742 211.0 1.3e-56
B6CQS9 Pru du 1.0101 160 738 209.9 2.8e-56
AAO25113 Mal d 1.0304 159 737 209.6 3.3e-56
AAD26545 Mal d 1.0202 159 735 209.1 4.8e-56
AAB01362 Mal d 1.0201 159 735 209.1 4.8e-56
CAA96536 Mal d 1.0402 160 734 208.8 5.9e-56
CAA96537 Mal d 1.0403 160 734 208.8 5.9e-56
AAD26548 Mal d 1.0204 159 731 208.0 1e-55
AAD13683 Mal d 1.0206 159 730 207.7 1.3e-55
AAK13030 Mal d 1.0207 159 729 207.4 1.5e-55
AAD26547 Mal d 1.0203 159 729 207.4 1.5e-55
ABZ81046 Que a 1.0301 160 728 207.1 1.9e-55
AAD26558 Mal d 1.0205 159 727 206.9 2.2e-55
O65200 Pyr c 1 159 723 205.8 4.8e-55
CAD32318 Mal d 1.0208 158 722 205.5 5.7e-55
AAK13027 Mal d 1.0302 159 721 205.2 7e-55
Q39427 Bet v 1.0205 160 721 205.2 7.1e-55
AAG40331 Cor a 1.0404 161 720 204.9 8.6e-55
AUH28179 Que m 1.0101 160 719 204.6 1e-54
AAD48405 Cor a 1.0401 161 719 204.6 1e-54
AAD26546 Mal d 1.0103 159 717 204.1 1.5e-54
CAA96534 Mal d 1.0301 159 716 203.8 1.8e-54
P43186 Bet v 1.0204 160 716 203.8 1.8e-54
AAG40329 Cor a 1.0402 161 716 203.8 1.9e-54
AAD29671 Mal d 1.0108 159 715 203.6 2.2e-54
AAD26552 Mal d 1.0104 159 713 203.0 3.2e-54
AAG40330 Cor a 1.0403 161 713 203.0 3.3e-54
AAD26555 Mal d 1.0107 159 710 202.2 5.7e-54
CAA04828.1 Bet v 1.0206 159 710 202.2 5.7e-54
CAA58646 Mal d 1.0101 159 710 202.2 5.7e-54
AAD26554 Mal d 1.0106 159 709 201.9 6.9e-54
AAD26553 Mal d 1.0105 159 709 201.9 6.9e-54
ABZ81047 Que a 1.0401 160 709 201.9 7e-54
Q256S7 Fra a 1 160 708 201.6 8.4e-54
Q256S2 Fra a 1 160 708 201.6 8.4e-54
Q3T923 Fra a 1 160 706 201.1 1.2e-53
AAK13029 Mal d 1.0109 159 704 200.5 1.8e-53
AAK13028 Mal d 1.0303 159 703 200.2 2.2e-53
CAA96548 Cor a 1.0201 160 703 200.2 2.2e-53
P43184 Bet v 1.0203 160 703 200.2 2.2e-53
CAA88833 Mal d 1.0102 159 701 199.7 3.2e-53
CAA54421 Bet v 1.0201 160 700 199.4 3.9e-53
Q256S6 Fra a 1 160 699 199.1 4.7e-53
CAB02160 Bet v 1.0113 160 696 198.3 8.3e-53
CAA33887 Bet v 1.0101 160 695 198.0 1e-52
CAB02159 Bet v 1.0112 160 695 198.0 1e-52
CAA54481 Bet v 1.0202 160 694 197.8 1.2e-52
CAB02156 Bet v 1.0109 160 694 197.8 1.2e-52
CAA04827.1 Bet v 1.0116 159 693 197.5 1.5e-52
CAB02161 Bet v 1.0114 160 693 197.5 1.5e-52
CAB02217 Car b 1.0302 161 693 197.5 1.5e-52
ABZ81045 Que a 1.0201 159 692 197.2 1.8e-52
CAA07329.1 Bet v 1.0118 160 689 196.4 3.2e-52
AAB24432 Aln g 1 160 689 196.4 3.2e-52
CAA50325 Cor a 1.0103 160 689 196.4 3.2e-52
Q256S4 Fra a 1 159 687 195.8 4.6e-52
CAA54487 Bet v 1.0106 160 684 195.0 8.2e-52
CAA54483 Bet v 1.0103 160 683 194.7 1e-51
P38948 Aln g 1 159 682 194.5 1.2e-51
CAA07323.1 Bet v 1.0117 160 682 194.5 1.2e-51
CAB02155 Bet v 1.0108 160 681 194.2 1.5e-51
CAA54485 Bet v 1.0105 160 681 194.2 1.5e-51
CAB02216 Car b 1.0301 161 680 193.9 1.8e-51
CAA54484 Bet v 1.0104 160 679 193.6 2.1e-51
CAA54482 Bet v 1.0102 160 678 193.4 2.6e-51
CAA50327 Cor a 1.0101 160 677 193.1 3.1e-51
CAA96547 Bet v 1.0115 160 676 192.8 3.8e-51
CAB02157 Bet v 1.0110 160 676 192.8 3.8e-51
ACF75030.1 Bet v 1.0207 150 673 192.0 6.1e-51
CAB02158 Bet v 1.0111 160 673 192.0 6.7e-51
QGS84240 Que i 1.0101 159 671 191.4 9.8e-51
Q08407 Cor a 1 159 670 191.2 1.2e-50
CAA54489 Bet v 1.0107 160 669 190.9 1.4e-50
QOL10866 Que ac 1.0101 159 667 190.3 2.1e-50
CAA50328 Cor a 1.0102 160 667 190.3 2.1e-50
ABZ81040 Car b 1.0109 160 661 188.7 6.6e-50
ABZ81043 Car b 1.0112 160 657 187.6 1.4e-49
ABZ81042 Car b 1.0111 160 657 187.6 1.4e-49
ADK39021 Ost c 1.0101 160 656 187.3 1.7e-49
ABZ81041 Car b 1.0110 160 656 187.3 1.7e-49
CAA50326 Cor a 1.0104 160 655 187.0 2.1e-49
CAB02209 Car b 1.0106 160 654 186.8 2.5e-49
ABZ81044 Car b 1.0113 160 651 185.9 4.5e-49
CAB02207 Car b 1.0104 160 651 185.9 4.5e-49
CAB02206 Car b 1.0103 160 650 185.7 5.4e-49
CAB02213 Car b 1.0107 160 648 185.1 7.9e-49
CAB02208 Car b 1.0105 160 647 184.8 9.6e-49
ABC41615.1 Bet v 1.0119 150 639 182.7 4e-48
CAA47357 Car b 1.0102 159 639 182.6 4.4e-48
CAB02215 Car b 1.0108 160 638 182.3 5.3e-48
AFN42528 Can s 5.0101 161 637 182.1 6.5e-48
P38950 Car b 1 159 635 181.5 9.4e-48
P38949 Car b 1 159 626 179.0 5.2e-47
CAM31908 Act c 8.0101 159 597 171.1 1.3e-44
Q0Z8U9 Rub i 1.0101 137 581 166.8 2.3e-43
CAM31909 Act d 8.0101 157 559 160.6 1.8e-41
AHC08073 Sola l 4.0101 160 556 159.8 3.3e-41
NP_001275580 Sola l 4.0201 160 553 158.9 5.9e-41
CAA43637 Pha v 1 156 548 157.6 1.5e-40
P25985 Pha v 1 155 541 155.7 5.6e-40
CAA42646 Gly m 4 158 538 154.8 1e-39
CAA43636 Pha v 1 155 536 154.3 1.5e-39
AAQ91847 Ara h 8.0101 157 519 149.6 3.8e-38
Q2VU97 Vig r 1.0101 155 499 144.1 1.7e-36
CAA75803 Lyc e 4.0101 178 485 140.2 3e-35
EF436550 Ara h 8.0201 153 478 138.3 9.1e-35
AAL76932 Dau c 1.0201 154 437 127.0 2.3e-31
P92918 Api g 1.0201 159 436 126.7 2.9e-31
CAA67246 Pet c PR10 155 430 125.1 8.9e-31
P49372 Api g 1 154 421 122.6 4.9e-30
AAB92255 Tar o RAP 157 415 121.0 1.6e-29
BAA13604 Dau c 1.0102 154 405 118.2 1e-28
CAB03716 Dau c 1.0104 154 403 117.7 1.5e-28
AAB01092 Dau c 1.0101 168 403 117.6 1.7e-28
CAB06416 Dau c 1.0105 154 400 116.8 2.7e-28
CAB03715 Dau c 1.0103 154 386 113.0 3.9e-27
Q5ULZ4 Fra a 1.0101 100 303 90.4 1.6e-20
P85126 Que a 1.0101 50 247 75.4 2.5e-16
Q9ZWP8 Vig r 6.0101 155 152 48.6 9.7e-08
Q9S8Q4 Cas s 1 24 120 40.9 3e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 286.1 bits 1015,  Expect = 3e-79
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 2. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 230.3 bits 812,  Expect = 2e-62
 Identities = 123/160 76%, Positives = 147/160 91%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFT+E+E T+ I P RLFKAFVLDADNLIPK+AP+AIKS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQF YVKHRIDEID ANFTY  ++IEGD ++E LEKI+YEIK+VASPDGGSILK+TSK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG++EIKE+++ AGKE+A+G+FKAVEAYLLA+  AY+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 229.4 bits 809,  Expect = 4e-62
 Identities = 121/160 75%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYE+E+T+VI PARLFKAFVLDADNLIPKV PQA+KSSEIIEG+GGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHR D ID ANFTYA ++IEGDA+++ +EKI+YE K+VAS +GGSILKS S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YH+KGDHEIKE+ +K GKE+ASG+FKAVE YLLA+P AY+
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 4. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 223.1 bits 786,  Expect = 3e-60
 Identities = 117/160 73%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYE+E T+VI P +LFKAF+LDADNLIPKVAP A+K +EI+EG GG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHR+D ID  N++Y+ TLIEGDA+S+ +E IAY+IKLVASPDGGSI+K+TS 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+Q+KAGKE+A+G+FK VEAYLLANP AY+
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 5. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 221.7 bits 781,  Expect = 8e-60
 Identities = 119/160 74%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI PARLFK FVLD+DNLIPKVAP+AIKS EIIEG+GGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS FNY+K++++EID ANF+Y  ++IEGDA+S+ LEKI YEIK+VASP GGSILKS SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHT GDHE+K++QIKAGKE+ASG+FKAVE YLLA+  AY+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 219.0 bits 771,  Expect = 5e-59
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESE T+ I P RLFKAFVLDADNL+PK+APQAIK SEI+EG GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID ID  N++Y+ TLIEGDA+ +TLEKI+YE KLVASP GGSI+KSTS 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGKE+AS +FK +E YL  +P AY+
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 7. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 217.9 bits 767,  Expect = 1e-58
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESE T+ I P RLFKAFVLDADNL+PK+APQAIK SEI+EG GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID ID  N +Y+ TLIEGDA+ + LEKI+YE KLVASP GGSI+KSTS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P AY+
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 8. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 213.5 bits 751,  Expect = 2e-57
 Identities = 112/160 70%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI   RLFKAF+LD DNLIPK+APQAIKS+EIIEG GG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVK+R++ ID  NFTY+ ++IEGD +S+ LEKI YE KL+ASPDGGSI+K+TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YH KGD EIKE+++KAGKE+ASG+FK +EAYLLA+  AY+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 211.0 bits 742,  Expect = 1e-56
 Identities = 111/160 69%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE E T+VI PARLFK+FVLDADNLIPKVAP+ + S+E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS+F Y+KHR+DEID+ANF Y  ++IEG  + +TLEKI+YEIK+VA+P GGSILK TSK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD  + E++IKAGKE+ +G+FKAVE YL+A+P AY+
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 10. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 209.9 bits 738,  Expect = 3e-56
 Identities = 107/160 66%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG+FTY  E+T+VI P RLFKA+VL+AD LIPK+APQ++KS+EI+EG GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS+++YVKH+ID +D  NF Y  +L+EGDA+S+ +EKI+YEIKLVAS DGGS++KSTS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+ +KAGKE+A+G+FK +E YL+ANP AY+
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 11. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 209.6 bits 737,  Expect = 3e-56
 Identities = 114/159 71%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESE T+VI PARLF AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS ++YVKHRID +D  NF Y  ++IEGDAISET+EKI+YE KLVAS   GS++KSTS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YLL +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 209.1 bits 735,  Expect = 5e-56
 Identities = 110/159 69%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 209.1 bits 735,  Expect = 5e-56
 Identities = 110/159 69%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 208.8 bits 734,  Expect = 6e-56
 Identities = 109/160 68%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E T+VI   RLFKAF+LD DNLIPK+APQAIKS++IIEG GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVK+R++ ID  NFTY+ ++IEGD +S+ LEKI YE KL+ASPDGGSI+K+ S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YH KGD EIKE+++KAGKE+ASG+FK +EAYLLA+  AY+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 208.8 bits 734,  Expect = 6e-56
 Identities = 110/160 68%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E T+VI   RLFKAF+LD DNLIPK+APQAIKS+EIIEG GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVK+R++ ID  NFTY+ ++IEGD +S+ LEKI YE KL+ASPDGGSI+K+TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            Y  KGD EIKE+++KAGKE+ASG+FK +EAYLLA+  AY+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 16. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 208.0 bits 731,  Expect = 1e-55
 Identities = 109/159 68%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KL+AS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 207.7 bits 730,  Expect = 1e-55
 Identities = 109/159 68%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFK FVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 207.4 bits 729,  Expect = 2e-55
 Identities = 109/159 68%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 207.4 bits 729,  Expect = 2e-55
 Identities = 109/159 68%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E++L  +P AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 20. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 207.1 bits 728,  Expect = 2e-55
 Identities = 110/159 69%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESE  +VI PARLFKAFVLD+DNLIPKV PQA+KS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ + KHRID ID  NFTY+ ++IEGDA+ + LE ++ E K+VASPDGGSI+KSTSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            Y+TKGD ++ ++ I+ GKE+AS +FKAVEAYL+A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 206.9 bits 727,  Expect = 2e-55
 Identities = 109/159 68%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++ AGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 22. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 205.8 bits 723,  Expect = 5e-55
 Identities = 109/159 68%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG++T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHR+D ID A+++YA TLIEGDA+++T+EKI+YE KLVAS   GS +KS S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 205.5 bits 722,  Expect = 6e-55
 Identities = 109/158 68%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GV+TYE+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            GSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            HTKGD EI E+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 24. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 205.2 bits 721,  Expect = 7e-55
 Identities = 112/159 70%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESE T+VI PARLF AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS ++YVKHRID +D  NF Y  ++IEGDAISET+EKI+YE KLVA+   GS++KSTS 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YLL +  AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 25. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 205.2 bits 721,  Expect = 7e-55
 Identities = 110/160 68%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNLIPKVAPQAI S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIKLVA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +++KA KE+A  +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 204.9 bits 720,  Expect = 9e-55
 Identities = 110/159 69%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF+YE E T+VI PARLFK+FVLDADNLIPKVAPQ   S+E +EG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGG-SILKSTS 119
            EG++F Y+KH+++EID+ANF Y  ++IEG  +  TLEKI YEIK+ A+P GG SILK TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            KYHTKG+  I E++IKAGKE+A+G+FKAVEAYLLA+P AY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 27. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 204.6 bits 719,  Expect = 1e-54
 Identities = 107/160 66%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV  YESE  +VI PARLFKAFVLD+DNLIPKV PQA+KS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ + KHRID ID  NFT++ ++IEGDA+ + LE ++ E K+VASPDGGSI+KST K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            Y+TKGD ++ ++ I+ GKE+ASG+FKAVEAYL+A+P  Y+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGYY 160

Sequence Alignment: 28. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 204.6 bits 719,  Expect = 1e-54
 Identities = 110/159 69%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE E T+VI PARLFK+FVLDADNLIPKVAPQ   S+E +EG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGG-SILKSTS 119
            EG++F Y+KH+++EID+ANF Y  ++IEG  +  TLEKI+YEIK+ A+P GG SILK TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            KYHTKG+  I E++IKAGKE+A+G+FKAVEAYLLA+P AY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 29. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 204.1 bits 717,  Expect = 2e-54
 Identities = 108/159 67%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 203.8 bits 716,  Expect = 2e-54
 Identities = 111/159 69%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E T+VI PARLF AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS ++YVKHRID +D  NF Y  ++IEGDAISET+EKI+YE KLVAS   GS++KSTS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTK D EIKE+++KAGKE+AS +FK +E YLLA+  AY+
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 31. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 203.8 bits 716,  Expect = 2e-54
 Identities = 109/160 68%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YESETT+VI  ARLFKAF+LD DNLIPKVAPQAI S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 203.8 bits 716,  Expect = 2e-54
 Identities = 109/159 68%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF+YE E T+VI PARLFK+FVLDADNLIPKVAPQ    +E +EG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGG-SILKSTS 119
            EGS+F Y+KH+++EID+ANF Y  ++IEG  +  TLEKI+YEIK+ A+P GG SILK TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            KYHTKG+  I E++IKAGKE+A+G+FKAVEAYLLA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 33. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 203.6 bits 715,  Expect = 2e-54
 Identities = 108/159 67%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 34. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 203.0 bits 713,  Expect = 3e-54
 Identities = 108/159 67%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 35. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 203.0 bits 713,  Expect = 3e-54
 Identities = 109/159 68%, Positives = 133/159 83%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE E T+VI PARLFK+FVLDADNLIPKVAPQ    +E +EG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGG-SILKSTS 119
            EGS+F Y+KH+++EID+ANF Y  ++IEG  +  TLEKI+YEIK+ A+P GG SILK TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            KYHTKG+  I E++IKAGKE+A+G+FKAVEAYLLA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 36. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 202.2 bits 710,  Expect = 6e-54
 Identities = 107/159 67%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGK +A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 37. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 202.2 bits 710,  Expect = 6e-54
 Identities = 109/159 68%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YESETT+VI  ARLFKAF+LD DNLIPKVAPQAI S E IEG+GGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            GS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIKLVA+PDGGSILK ++KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            HTKGDHE+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 38. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 202.2 bits 710,  Expect = 6e-54
 Identities = 107/159 67%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++K GKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 39. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 201.9 bits 709,  Expect = 7e-54
 Identities = 107/159 67%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+E I+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 40. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 201.9 bits 709,  Expect = 7e-54
 Identities = 108/159 67%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 41. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 201.9 bits 709,  Expect = 7e-54
 Identities = 108/159 67%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFT+ES+ T+VI PARLFKA+ LD+DNLI KV PQAIKS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ + KHRID ID  NFTY+ ++IEGDA+ + LE ++ E K+VASPDGGSI KSTSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            Y+TKGD ++ ++ I+ GKE+ASG+FKAVEAYL+A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 42. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 201.6 bits 708,  Expect = 8e-54
 Identities = 106/160 66%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+TYE+E T+ I   +LFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+S+ +EKI YE KLV++P GG+I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P+ Y+
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 43. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 201.6 bits 708,  Expect = 8e-54
 Identities = 105/160 65%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+TYE+E T+ I   +LFKAFVLDADNLIPK+APQA+K +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+SE +EKI YE KLV++P GG+I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+A+ +FK +E YL  +P+ Y+
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 44. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 201.1 bits 706,  Expect = 1e-53
 Identities = 104/160 65%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+TYE+E T+ I   +LFKAFVLDADNLIPK+APQA+K +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+S+ +EKI YE KLV++P GG+++K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P+ Y+
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 45. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 200.5 bits 704,  Expect = 2e-53
 Identities = 107/159 67%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA    GS +KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+ EIKE+++K GKE+A G+FK +E+YL  +P AY+
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 46. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 200.2 bits 703,  Expect = 2e-53
 Identities = 109/159 68%, Positives = 133/159 83%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYE E T+VI PARL+ AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS ++YVKH+ID +D  NF Y  ++IEGDAISET+EKI+YE KLVAS   GS++KS S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YLL +  AY+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 47. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 200.2 bits 703,  Expect = 2e-53
 Identities = 103/160 64%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E+T+VI  ARLFKAF+LD +NLIPKVAPQA+ S E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R++E+D+ NF Y+ T+IEG  + + +EKI  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+  ++IK GKE+  G+F+AVEAYLLA+  AY+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 200.2 bits 703,  Expect = 2e-53
 Identities = 107/160 66%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YESETT+VI  ARLFKAF+L+ D LIPKVAPQAI S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 199.7 bits 701,  Expect = 3e-53
 Identities = 105/159 66%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA   G +I KS S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YH KG+ EIKE+++K GKE+  G+FK +E+YL  +P AY+
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 50. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 199.4 bits 700,  Expect = 4e-53
 Identities = 106/160 66%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+L+ D LIPKVAPQAI S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 51. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 199.1 bits 699,  Expect = 5e-53
 Identities = 105/160 65%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG +TYE+E T+ I   +LFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+S+ +EKI YE KLV++P GG+I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P+ Y+
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 198.3 bits 696,  Expect = 8e-53
 Identities = 104/160 65%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL+PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGGSILK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 198.0 bits 695,  Expect = 1e-52
 Identities = 105/160 65%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIK+VA+PDGGSILK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 198.0 bits 695,  Expect = 1e-52
 Identities = 105/160 65%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIK+VA+PDGGSILK ++K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 197.8 bits 694,  Expect = 1e-52
 Identities = 106/160 66%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YESETT+VI  ARLFKAF+L+ D LIPKVAPQAI S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD+E+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 197.8 bits 694,  Expect = 1e-52
 Identities = 104/160 65%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGGSILK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 197.5 bits 693,  Expect = 1e-52
 Identities = 104/159 65%, Positives = 130/159 81%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YE+E T+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            G  F YVK R+DE+D+ANF Y+ +LIEG  + +TLEKI+ EIK+VA+PDGGSILK ++KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            HTKGDHE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 58. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 197.5 bits 693,  Expect = 1e-52
 Identities = 105/160 65%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIK+VA+PDGGSILK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 197.5 bits 693,  Expect = 1e-52
 Identities = 104/160 65%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD +NLIPKVAPQA+ S E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS   YVK R++E+D+ NF Y+ T+IEG  + + +EKI  EIK+VA+PDGGSILK TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+  ++IK GKE   G++K VEAYLLA+ A Y+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 60. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 197.2 bits 692,  Expect = 2e-52
 Identities = 106/158 67%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFT+ES+ T+VI PARLFKA+ LD+DNLI KV PQAIKS+EIIEG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E S+F Y KHRID +D  N TY+ ++IEGDA++  +E ++ EIK VASPDGGSI+KST+K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            Y+TKGD ++KE+QI+A  E+A+G++KAVEAYL+A+P  Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 61. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 196.4 bits 689,  Expect = 3e-52
 Identities = 105/160 65%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNLIPKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIKLVA+PDGGSIL+ ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 196.4 bits 689,  Expect = 3e-52
 Identities = 103/160 64%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFKAF+LD D L+PKVAP+A+ S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F YVK R+DE+D  NF Y+ ++IEG A+ + LEK+  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +HTKGDHEI  +QIK  KE+A G++KAVE+YLLA+  AY+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 196.4 bits 689,  Expect = 3e-52
 Identities = 102/160 63%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVK R+DE+DN NFTY+ T+IEGD + + LEK+ +E+K+VA+P GGSILK +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHEI  ++IK  KE A  +++AVE YLLA+ A Y+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 64. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 195.8 bits 687,  Expect = 5e-52
 Identities = 104/159 65%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+TYE+E T+ I   +LFKAFVLDADNLIPK+APQA+K +EI+EG GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+S+ +EKI YE KLV++P G +I+K+TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P+ Y+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 195.0 bits 684,  Expect = 8e-52
 Identities = 103/160 64%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E T+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y+ ++IEG  + +TLEKI+ EIK+VA+P+GGSILK  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +QIKA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 194.7 bits 683,  Expect = 1e-51
 Identities = 103/160 64%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E T+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y+ ++IEG  + +TLEKI+ EIK+VA+P+GGSILK  +K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +QIKA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 194.5 bits 682,  Expect = 1e-51
 Identities = 102/159 64%, Positives = 129/159 81%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YE+ET +VI  ARLFKAF+LD D L+PKVAP+A+ S E IEG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            GS F YVK R+DE+D  NF Y+ ++IEG A+ + LEK+  EIK+VA+PDGGSILK ++K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            HTKGDHEI  +QIK  KE+A G++KAVE+YLLA+  AY+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 68. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 194.5 bits 682,  Expect = 1e-51
 Identities = 102/160 63%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 194.2 bits 681,  Expect = 1e-51
 Identities = 101/160 63%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 194.2 bits 681,  Expect = 1e-51
 Identities = 102/160 63%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YESETT+VI  ARLFKAF+L+ DNLIPKVAPQAI S E IEG+GGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 193.9 bits 680,  Expect = 2e-51
 Identities = 102/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD + LIPKV+PQA+ S E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS   YVK R++E+D+ NF Y+ T+IEG  + + +EKI  EIK+VA+PDGGSILK TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+  ++IK GKE   G++K VEAYLLA+ A Y+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 193.6 bits 679,  Expect = 2e-51
 Identities = 103/160 64%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE E T+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y+ ++IEG  + +TLEKI+ EIK+VA+P+GGSILK  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +QIKA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 193.4 bits 678,  Expect = 3e-51
 Identities = 101/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE ETT+VI  ARLFKAF+LD DNL+PKVAPQAI S E IEG+GGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 193.1 bits 677,  Expect = 3e-51
 Identities = 100/160 62%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE ET +VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVK R+DE+DN NFTY+ T+IEGD + + LEK+ +E+K+VA+P GGSILK +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 75. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 192.8 bits 676,  Expect = 4e-51
 Identities = 104/160 65%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+ + NF Y+ ++IEG  I +TLEKI+ EIK+VA+PDG SILK ++K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKGDHE+K +QIKA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 192.8 bits 676,  Expect = 4e-51
 Identities = 101/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I + LEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 192.0 bits 673,  Expect = 6e-51
 Identities = 102/150 68%, Positives = 127/150 84%, Gaps = 0/150 0%
Query  4    FTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGEGS 63
            F YESETT+VI  ARLFKAF+L+ DNLIPKVAPQAI S E IEG+GGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHT 123
             F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIK+VA+PDGGSILK ++KYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEIKEDQIKAGKEEASGIFKAVEAYLL 153
            KGDHE+K +++KA KE+   +++AVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 78. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 192.0 bits 673,  Expect = 7e-51
 Identities = 101/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
             G  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 191.4 bits 671,  Expect = 1e-50
 Identities = 106/158 67%, Positives = 133/158 84%, Gaps = 1/158 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV T+ES+ T+VI PARLFKAFVLD+DNLIPKV PQAIKS E IEG+GGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E S+F Y KHRID +D  N TY+ ++IEGDA+++ +  ++ EIK+VASPDGGSI KST+K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            Y+TKGD ++KE+QI+A  E+ +G+ KAVEAYLLA+P  Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 80. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 191.2 bits 670,  Expect = 1e-50
 Identities = 99/159 62%, Positives = 127/159 79%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YE ET +VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            GS++ YVK R+DE+DN NFTY+ T+IEGD + + LEK+ +E+K+VA+P GGSILK +SK+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 81. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 190.9 bits 669,  Expect = 1e-50
 Identities = 98/160 61%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+E T+VI  AR+FKAF+LD D L+PKVAPQAI S E IEG+GGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 82. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 190.3 bits 667,  Expect = 2e-50
 Identities = 100/159 62%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV+ YES+ T+VI PARLFKAFVLD+DNLI KV P+A+KS+EIIEG+GGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E S+  Y KHRID +D  N +Y+ ++IEG+A+++ +  I+ E+K+VASPDGGSI+KST+K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            Y+TKG  ++KE+QI+A  E+ +G+FKAVEAYLLA+P  Y+
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 83. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 190.3 bits 667,  Expect = 2e-50
 Identities = 99/160 61%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE ET +VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVK R+DE+DN NF Y+ T+IEGD + + LEK+  E+K+VA+P GGSILK +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 188.7 bits 661,  Expect = 7e-50
 Identities = 97/160 60%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSILK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 85. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 187.6 bits 657,  Expect = 1e-49
 Identities = 96/160 60%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 86. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 187.6 bits 657,  Expect = 1e-49
 Identities = 96/160 60%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 87. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 187.3 bits 656,  Expect = 2e-49
 Identities = 96/160 60%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSILK +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 88. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 187.3 bits 656,  Expect = 2e-49
 Identities = 95/160 59%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGS++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 89. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 187.0 bits 655,  Expect = 2e-49
 Identities = 97/160 60%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE ET +VI+ ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS++ YVK R+DE+DN NF Y+ T+IEGD + + LEK+  E+K+VA+P GGS LK +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 186.8 bits 654,  Expect = 3e-49
 Identities = 96/160 60%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 185.9 bits 651,  Expect = 4e-49
 Identities = 95/160 59%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG  F +VK R+DE+DNANF Y+ T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 185.9 bits 651,  Expect = 4e-49
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+   Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 185.7 bits 650,  Expect = 5e-49
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+   Y+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 185.1 bits 648,  Expect = 8e-49
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF ++ T+IEGD + + LEK++ E+K+VA+P GGSILK + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 184.8 bits 647,  Expect = 1e-48
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+   Y+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 96. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 182.7 bits 639,  Expect = 4e-48
 Identities = 95/150 63%, Positives = 120/150 80%, Gaps = 0/150 0%
Query  4    FTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGEGS 63
            F YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S + IEG+GGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHT 123
             F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGG ILK ++KYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEIKEDQIKAGKEEASGIFKAVEAYLL 153
            KG+HE+K +Q+KA KE    +++AVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 97. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 182.6 bits 639,  Expect = 4e-48
 Identities = 94/159 59%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            GS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            H KG HE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 98. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 182.3 bits 638,  Expect = 5e-48
 Identities = 93/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVF YE+ET +V+  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS F +VK R+DE+DNANF ++ T+IEGD + + LEK++ E+ +VA+P GGSILK + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 99. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 182.1 bits 637,  Expect = 7e-48
 Identities = 94/160 58%, Positives = 130/160 81%, Gaps = 1/160 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFTYESE T+ I PARLFKAFVLD DNL+PK+APQA++  EI+EG+GG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAI-SETLEKIAYEIKLVASPDGGSILKSTS 119
            +G  F YVKH+I+ ID  ++TY+ ++IEGDA+    LEKI +E KLVAS DGG+++K+ S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            KY++ GD ++ E+++K G+++A+ ++K VEAYL  +P AY+
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 100. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 181.5 bits 635,  Expect = 9e-48
 Identities = 93/159 58%, Positives = 126/159 79%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YE+ETT+VI  ARLFKAF+LD + LIPKV+PQA+ S E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            GS   YVK R++EID+ NF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            H KG HE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 179.0 bits 626,  Expect = 5e-47
 Identities = 92/159 57%, Positives = 123/159 77%, Gaps = 0/159 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVF YE+ET +VI  ARLFK++VLD D LIPKVAPQ I S E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
            G  F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160
            H KG HE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 171.1 bits 597,  Expect = 1e-44
 Identities = 90/156 57%, Positives = 121/156 77%, Gaps = 0/156 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV TY+ E  + + P +L+KAF+LD D L+PKV P+AIK  +I+EG G  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS+   VK+R+D ID  N+TY+ T+IEGD ++E +E I+Y IK+VA PDGGSI K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            Y TKGD ++ E++IK GKE+A+ IFKA+EAYLLANP
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 103. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 166.8 bits 581,  Expect = 2e-43
 Identities = 88/135 65%, Positives = 112/135 82%, Gaps = 1/135 0%
Query  11   TTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGEGSQFNYVKH 70
            T+VI P +LFKAFVLDADNLIPK+APQA+KS EIIEG GG GT+KKI +GEG++ +YVKH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHTKGDHEIK 130
            +ID +D  NF Y+ ++ EGDA+ + +EKI+YEIKLVAS   GSI+K+TS YH KG  EIK
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  EDQIKAGKEEASGIFK 146
            E+Q+K GKE A+G+FK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 160.6 bits 559,  Expect = 2e-41
 Identities = 88/155 56%, Positives = 112/155 72%, Gaps = 1/155 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG  TY+ E  + I+  ++FKAFVLD D +IPK  P+AI   + +EG GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS    VKHRID +D  NFTY+ ++IEG A+ + +E I+Y IK+VA+PDGG I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            Y  K D ++ E++IKAGKE ASGIFK VEAYLLANP
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 105. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 159.8 bits 556,  Expect = 3e-41
 Identities = 84/159 52%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV TY  E+TT I+P RLFKA+VLD DNL+PK+  Q +K++E IEG GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG    Y+KH+I  ID+ N+    +LIEGD + E LE I Y+IK+ A+ +GG + K+T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            YHTKGDH + E++   G+E    I KAVEAYLLANP+ Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 158.9 bits 553,  Expect = 6e-41
 Identities = 81/159 50%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV T+  E+TT I P RLFK +VLD D+L+PK+  + +KS EI+EG GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG    Y+KH+I  ID+ N+    +LIEGD + + LE IAY++K+ A+ DGG + K+T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            YHTKGDH + E++   GK +A  +FKA+EAYLLANP+ Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 157.6 bits 548,  Expect = 1e-40
 Identities = 81/156 51%, Positives = 113/156 72%, Gaps = 0/156 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFT+E +TT+ + PA L+KA   DAD + PK  P + KS EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E  +  +V H+I+ ID AN+ Y+ +++ G A+ ET EKI ++ KL   P+GGS++K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            YH+KGD    ED++KAGK ++  +FKAVEAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 155.7 bits 541,  Expect = 6e-40
 Identities = 80/155 51%, Positives = 112/155 72%, Gaps = 0/155 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
            GVFT+E +TT+ + PA L+KA   DAD + PK  P + KS EI+EG+GGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
              +  +V H+I+ ID AN+ Y+ +++ G A+ ET EKI ++ KL   P+GGS++K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            H+KGD    ED++KAGK ++  +FKAVEAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 109. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 154.8 bits 538,  Expect = 1e-39
 Identities = 84/155 54%, Positives = 114/155 73%, Gaps = 1/155 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFT+E E  + + PA L+KA+V DADN+IPK A  + KS E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E  +  +V H+I+ ID AN+ Y+ +++ G A+ +T EKI ++ KLVA P+GGS  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            Y TKGD E  +D++K GK +A  +FKA+EAYLLA+P
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 154.3 bits 536,  Expect = 1e-39
 Identities = 80/155 51%, Positives = 116/155 74%, Gaps = 1/155 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            M VFT+E +TT+ + PA L+KA+V DAD ++PK A  + KS EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E  +  +V H+I+EID AN+ Y+ +++ G A+ +T EKI+ + KL   P+GGS++K + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            YH+KGD    ED++KAGK ++  +FK +EAYLLANP
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 149.6 bits 519,  Expect = 4e-38
 Identities = 77/157 49%, Positives = 112/157 71%, Gaps = 2/157 1%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGVFT+E E T+ + PA+L+ A + DAD++ PK+    +KS EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E  +  ++ H+++ ID AN+ Y  +++ G A+  T EKI +E KLV  P+GGSI K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159
            YHTKGD +  E+++K GK +  G+F+A+E Y+LANP  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 144.1 bits 499,  Expect = 2e-36
 Identities = 76/155 49%, Positives = 110/155 70%, Gaps = 1/155 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            M VFT++ + T+ + PA L+ A+  DADN+IPK A  + +S EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E  +  +V H+I+ +D AN+ Y+ +++ G A+ +T EKI  + K+    DGGS++K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156
            YH KGD    ED++KAGK ++  +FKAVEAYLLANP
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 140.2 bits 485,  Expect = 3e-35
 Identities = 72/146 49%, Positives = 102/146 69%, Gaps = 0/146 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV TY  E+TT I+P RLFKA+VLD DNL+PK+  Q +K++E IEG GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EG    Y+KH+I  ID+ N+    +LIEGD + E LE I Y+IK+ A+ +GG + K+T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFK 146
            YHTKGDH + E++   G+ E    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 138.3 bits 478,  Expect = 9e-35
 Identities = 75/153 49%, Positives = 110/153 71%, Gaps = 2/153 1%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV T+E E+T+ + PA+LFKA V+D D L PK+ P AI+S EI+EG+GGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E  + +YV H+ID ID A +TY  T+  G    E LEK++++ KL A+ DGGS +K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + ++  +  K+++ GIFKA+E Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 127.0 bits 437,  Expect = 2e-31
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV   E E  + ++  ++++ F+LD D + PKV PQ IKS EI+EG GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E +++  +K+++D ID A + Y  T I GD + E LE +  +  +V   DGG I+K+T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            Y+TKGD  + ED++K   E+++  FKAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 126.7 bits 436,  Expect = 3e-31
 Identities = 68/154 44%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV     E  + ++  ++++ F+LD D + PKV PQ IKS EI+EG GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            E +++  +K+++D ID A + Y  T I GD + + LE +  E  +V   DGG I+K+T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            Y+TKGD  + ED+IK   E+++  FKAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 125.1 bits 430,  Expect = 9e-31
 Identities = 68/155 43%, Positives = 102/155 65%, Gaps = 0/155 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV   E   T+ +  A+LFKA+ LD D L+P+V P AIK  EI+EG GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            + S +  +K++ID ID   FT++ ++I+GD +   ++ I   + +V + DGG    ST+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            ++TKGD  + E+ IK   ++ + IFKAVEAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 118. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 122.6 bits 421,  Expect = 5e-30
 Identities = 66/154 42%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MGV T+  E T+ ++  ++F+ FV+D D ++PK AP A KS EI +G GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            +G     +  RID ++   +T+  ++I+GD +   +E I   + LV + DGGSI K+T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + E+ IK   E+ + +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 121.0 bits 415,  Expect = 2e-29
 Identities = 60/152 39%, Positives = 96/152 63%, Gaps = 0/152 0%
Query  7    ESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGEGSQFN 66
            E E T+ ++P+ +FKAFV+D D + PK  P+  KS + IEG GG GTIK IT+ +G  F 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHTKGD 126
              KH++D ID+ NF+ + T+ EGD +   +E   + +K++ S DGGS+ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEIKEDQIKAGKEEASGIFKAVEAYLLANPAA 158
             ++ ++ +   KE     FKA+E Y++++P A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 118.2 bits 405,  Expect = 1e-28
 Identities = 63/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG  ++  E T+ ++  ++F   VLD D +IPK AP A KS ++ +G GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS    +  R D ++   +TY  T+I+GD + E +E I   + +V + DGGSI K+T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + E+ IK    + + +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 117.7 bits 403,  Expect = 2e-28
 Identities = 63/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG  ++  E T+ ++  ++F   VLD D +IPK AP A KS ++ +G GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS    +  R D ++   +TY  T+I+GD +   +E I   + +V + DGGSI K+T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + E+ IK   E+ + +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 117.6 bits 403,  Expect = 2e-28
 Identities = 63/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG  ++  E T+ ++  ++F   VLD D +IPK AP A KS ++ +G GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS    +  R D ++   +TY  T+I+GD + E +E I   + +V + DGGSI K+T+ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + E+ IK    + + +FKA+EAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 123. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 116.8 bits 400,  Expect = 3e-28
 Identities = 63/154 40%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG  ++  E T+ ++  ++F   VLD D +IPK AP A KS E+ +G GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS    +  R D ++   +TY  T+I+GD +   +E I   + +V + DGGSI K+T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + E+ IK    + + +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 113.0 bits 386,  Expect = 4e-27
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
            MG  ++  E T+ ++  ++F   VLD D +IPK A  A KS E+ +G GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
            EGS    +  R D ++   ++Y  T+I+GD +   +E I   + +V + DGGSI K+T+ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155
            +HTKGD  + E+ IK    + + +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 90.4 bits 303,  Expect = 2e-20
 Identities = 68/100 68%, Positives = 87/100 87%, Gaps = 39/100 39%
Query  22   AFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGEGSQFNYVKHRIDEIDNANFT 81
            AFVLDADNLIPK                      KITFGEGSQ+ YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHTKGDHEIKEDQIKAGKEEA 141
                 +EGDA+S+TLEKI YE KLV++P   +I+K+TSKYHTKGD EIKE+++KAGKE+A
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  SGIFKAVEAYLLANPAAYH 160
            + +FK +E YL  +P+ Y+
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 75.4 bits 247,  Expect = 3e-16
 Identities = 38/50 76%, Positives = 45/50 90%, Gaps = 0/50 0%
Query  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGP 51
            GVFT+ES+ T+VI PARLFKA+ LD+DNLI KV PQAIKS+EIIEG+GGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 48.6 bits 152,  Expect = 1e-07
 Identities = 35/146 23%, Positives = 63/146 43%, Gaps = 1/146 0%
Query  6    YESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGEGSQF 65
            + ++T   +    L+  +  D   ++PKV P+ +K  ++IEG GG GTI    F      
Sbjct  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
Query  66   NYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHTKG 125
            +Y +  I E D ++      +IEG  +++ L       KL    +  +++     Y    
Sbjct  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS 124
Query  126  DHEIKEDQIKAGKEEASGIFKAVEAYL 152
            D E K    K  +      ++ +E YL
Sbjct  125  DIEEKVTPTKTSQSTLM-YLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 40.9 bits 120,  Expect = 3e-06
 Identities = 19/24 79%, Positives = 22/24 91%, Gaps = 0/24 0%
Query  2    GVFTYESETTTVITPARLFKAFVL 25
            GVFT+ES+ T+VI PARLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.