The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG
EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH
YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
O50001 Pru ar 1 160 1018 216.1 3.6e-58
CAA96537 Mal d 1.0403 160 848 181.5 9.5e-48
CAA96535 Mal d 1.0401 160 848 181.5 9.5e-48
CAA96536 Mal d 1.0402 160 848 181.5 9.5e-48
Q2I6V8 Pru p 1.0101 160 839 179.7 3.4e-47
O24248 Pru av 1 160 838 179.5 3.9e-47
B6CQS9 Pru du 1.0101 160 817 175.2 7.5e-46
AAO25113 Mal d 1.0304 159 809 173.6 2.3e-45
AAK13027 Mal d 1.0302 159 800 171.8 8.2e-45
CAA96534 Mal d 1.0301 159 794 170.5 1.9e-44
AAK13028 Mal d 1.0303 159 790 169.7 3.4e-44
AAD26545 Mal d 1.0202 159 788 169.3 4.5e-44
AAB01362 Mal d 1.0201 159 788 169.3 4.5e-44
ACJ23864 Fag s 1.0101 160 786 168.9 6e-44
AAD26548 Mal d 1.0204 159 784 168.5 7.8e-44
AAD13683 Mal d 1.0206 159 783 168.3 9e-44
AAK13030 Mal d 1.0207 159 782 168.1 1e-43
AAD26547 Mal d 1.0203 159 782 168.1 1e-43
APD76154 Jug r 5.0101 160 782 168.1 1e-43
AAD26558 Mal d 1.0205 159 780 167.7 1.4e-43
AAD26554 Mal d 1.0106 159 776 166.9 2.4e-43
CAD32318 Mal d 1.0208 158 775 166.7 2.8e-43
O65200 Pyr c 1 159 774 166.5 3.2e-43
AAD26546 Mal d 1.0103 159 771 165.9 4.9e-43
AAD29671 Mal d 1.0108 159 769 165.4 6.5e-43
Q3T923 Fra a 1 160 769 165.4 6.5e-43
Q256S7 Fra a 1 160 769 165.4 6.5e-43
CAD10374 Cas s 1 160 766 164.8 1e-42
AAD26552 Mal d 1.0104 159 765 164.6 1.1e-42
CAA58646 Mal d 1.0101 159 764 164.4 1.3e-42
AAD26553 Mal d 1.0105 159 763 164.2 1.5e-42
Q256S2 Fra a 1 160 762 164.0 1.8e-42
AAD26555 Mal d 1.0107 159 760 163.6 2.3e-42
Q256S6 Fra a 1 160 760 163.6 2.3e-42
AAK13029 Mal d 1.0109 159 758 163.2 3.1e-42
CAA88833 Mal d 1.0102 159 753 162.2 6.2e-42
Q256S4 Fra a 1 159 750 161.6 9.5e-42
CAA96549 Cor a 1.0301 160 723 156.1 4.3e-40
ABZ81046 Que a 1.0301 160 702 151.8 8.3e-39
CAA54696.1 Bet v 1.0301 160 697 150.8 1.7e-38
AUH28179 Que m 1.0101 160 691 149.6 3.9e-38
AAG40329 Cor a 1.0402 161 683 147.9 1.2e-37
AAG40330 Cor a 1.0403 161 680 147.3 1.9e-37
QOL10866 Que ac 1.0101 159 675 146.3 3.7e-37
AAG40331 Cor a 1.0404 161 674 146.1 4.4e-37
ABZ81047 Que a 1.0401 160 673 145.9 5e-37
AAD48405 Cor a 1.0401 161 673 145.9 5e-37
Q39427 Bet v 1.0205 160 671 145.5 6.6e-37
ABZ81045 Que a 1.0201 159 670 145.3 7.6e-37
CAM31908 Act c 8.0101 159 666 144.5 1.3e-36
CAA96548 Cor a 1.0201 160 666 144.5 1.3e-36
AFN42528 Can s 5.0101 161 662 143.7 2.4e-36
QGS84240 Que i 1.0101 159 661 143.5 2.7e-36
P43186 Bet v 1.0204 160 660 143.3 3.1e-36
Q0Z8U9 Rub i 1.0101 137 658 142.9 3.5e-36
CAA04828.1 Bet v 1.0206 159 654 142.0 7.2e-36
CAA54421 Bet v 1.0201 160 650 141.2 1.3e-35
CAA54481 Bet v 1.0202 160 648 140.8 1.7e-35
P43184 Bet v 1.0203 160 647 140.6 2e-35
AAB24432 Aln g 1 160 646 140.4 2.2e-35
CAB02160 Bet v 1.0113 160 645 140.2 2.6e-35
CAM31909 Act d 8.0101 157 641 139.4 4.5e-35
CAA33887 Bet v 1.0101 160 640 139.2 5.2e-35
CAB02159 Bet v 1.0112 160 640 139.2 5.2e-35
P38948 Aln g 1 159 639 139.0 6e-35
CAB02156 Bet v 1.0109 160 639 139.0 6e-35
CAB02217 Car b 1.0302 161 639 139.0 6.1e-35
CAA04827.1 Bet v 1.0116 159 638 138.8 6.9e-35
CAB02161 Bet v 1.0114 160 638 138.8 7e-35
CAA07329.1 Bet v 1.0118 160 637 138.6 8e-35
CAA54487 Bet v 1.0106 160 633 137.8 1.4e-34
CAA54483 Bet v 1.0103 160 632 137.6 1.6e-34
CAB02157 Bet v 1.0110 160 631 137.4 1.9e-34
CAA07323.1 Bet v 1.0117 160 627 136.5 3.3e-34
CAA54484 Bet v 1.0104 160 627 136.5 3.3e-34
CAB02155 Bet v 1.0108 160 626 136.3 3.8e-34
CAB02216 Car b 1.0301 161 626 136.3 3.8e-34
CAA96547 Bet v 1.0115 160 622 135.5 6.6e-34
CAA54482 Bet v 1.0102 160 622 135.5 6.6e-34
CAA54485 Bet v 1.0105 160 620 135.1 8.8e-34
CAA50325 Cor a 1.0103 160 618 134.7 1.2e-33
CAA54489 Bet v 1.0107 160 618 134.7 1.2e-33
CAB02158 Bet v 1.0111 160 618 134.7 1.2e-33
CAA50327 Cor a 1.0101 160 609 132.9 4.2e-33
CAA50328 Cor a 1.0102 160 603 131.7 9.7e-33
Q08407 Cor a 1 159 602 131.5 1.1e-32
ACF75030.1 Bet v 1.0207 150 601 131.3 1.2e-32
CAB02206 Car b 1.0103 160 592 129.4 4.6e-32
CAB02207 Car b 1.0104 160 592 129.4 4.6e-32
CAB02208 Car b 1.0105 160 589 128.8 7e-32
ABZ81042 Car b 1.0111 160 582 127.4 1.9e-31
ABZ81043 Car b 1.0112 160 582 127.4 1.9e-31
ABZ81041 Car b 1.0110 160 581 127.2 2.2e-31
P38950 Car b 1 159 580 127.0 2.5e-31
CAB02209 Car b 1.0106 160 579 126.8 2.9e-31
ABZ81040 Car b 1.0109 160 578 126.6 3.3e-31
ABZ81044 Car b 1.0113 160 578 126.6 3.3e-31
CAA50326 Cor a 1.0104 160 577 126.4 3.8e-31
ADK39021 Ost c 1.0101 160 576 126.2 4.4e-31
ABC41615.1 Bet v 1.0119 150 568 124.5 1.3e-30
CAB02213 Car b 1.0107 160 567 124.3 1.6e-30
CAA47357 Car b 1.0102 159 564 123.7 2.4e-30
CAB02215 Car b 1.0108 160 557 122.3 6.4e-30
P38949 Car b 1 159 551 121.1 1.5e-29
NP_001275580 Sola l 4.0201 160 550 120.9 1.7e-29
AHC08073 Sola l 4.0101 160 537 118.2 1.1e-28
CAA42646 Gly m 4 158 532 117.2 2.1e-28
CAA43637 Pha v 1 156 520 114.8 1.1e-27
P25985 Pha v 1 155 513 113.3 3.1e-27
CAA43636 Pha v 1 155 513 113.3 3.1e-27
AAQ91847 Ara h 8.0101 157 506 111.9 8.3e-27
Q2VU97 Vig r 1.0101 155 486 107.9 1.4e-25
CAA67246 Pet c PR10 155 485 107.6 1.6e-25
P92918 Api g 1.0201 159 481 106.8 2.9e-25
AAL76932 Dau c 1.0201 154 470 104.6 1.3e-24
P49372 Api g 1 154 468 104.2 1.7e-24
CAA75803 Lyc e 4.0101 178 467 104.0 2.4e-24
EF436550 Ara h 8.0201 153 458 102.2 7.1e-24
AAB92255 Tar o RAP 157 446 99.7 3.9e-23
CAB03716 Dau c 1.0104 154 443 99.1 5.9e-23
CAB06416 Dau c 1.0105 154 440 98.5 9e-23
BAA13604 Dau c 1.0102 154 439 98.3 1e-22
AAB01092 Dau c 1.0101 168 437 97.9 1.5e-22
CAB03715 Dau c 1.0103 154 432 96.9 2.8e-22
Q5ULZ4 Fra a 1.0101 100 339 78.0 8.5e-17
P85126 Que a 1.0101 50 212 52.3 2.3e-09
Q9ZWP8 Vig r 6.0101 155 173 44.1 2.1e-06
P85524 Act d 11.0101 150 134 36.2 0.00049
Q9S8Q4 Cas s 1 24 118 33.3 0.00058
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 216.1 bits 1018,  Expect = 4e-58
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 2. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 181.5 bits 848,  Expect = 9e-48
 Identities = 127/160 79%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETEFTSVIP  +LFKAFILD DNLIPK+AP A+K TEI+EGDGGVGTIKKVTFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVK+RV+GIDKDN++YSY++IEGD LSD +E I Y+ KL+ASPDGGSI+KTTSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            Y  KGDVEIKEE+VKAGKEKA+GLFKL+EAYLLA+ DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 181.5 bits 848,  Expect = 9e-48
 Identities = 127/160 79%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNLIPK+AP A+K TEI+EGDGGVGTIKKVTFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVK+RV+GIDKDN++YSY++IEGD LSD +E I Y+ KL+ASPDGGSI+KTTSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YH KGDVEIKEE+VKAGKEKA+GLFKL+EAYLLA+ DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 181.5 bits 848,  Expect = 9e-48
 Identities = 126/160 78%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETEFTSVIP  +LFKAFILD DNLIPK+AP A+K T+I+EGDGGVGTIKKVTFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVK+RV+GIDKDN++YSY++IEGD LSD +E I Y+ KL+ASPDGGSI+KT SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YH KGDVEIKEE+VKAGKEKA+GLFKL+EAYLLA+ DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 179.7 bits 839,  Expect = 3e-47
 Identities = 123/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+EFTS IPP +LFKAF+LDADNL+PK+AP A+K +EILEGDGG GTIKK+TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D IDK+N SYSYTLIEGDAL D +E I+Y+ KLVASP GGSI+K+TSH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 6. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 179.5 bits 838,  Expect = 4e-47
 Identities = 122/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+EFTS IPP +LFKAF+LDADNL+PK+AP A+K +EILEGDGG GTIKK+TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D IDK+N SYSYTLIEGDAL D +E I+Y+ KLVASP GGSI+K+TSH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+VEIKEE+VKAGKEKA+ LFKL+E YL  +PDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 7. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 175.2 bits 817,  Expect = 8e-46
 Identities = 117/160 73%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG+FTY  E TSVIPP +LFKA++L+AD LIPK+AP +VK  EI+EGDGGVGTIKK++FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y+YVKH++DG+DKDN+ Y+Y+L+EGDALSD +E I+Y+IKLVAS DGGS++K+TS+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE VKAGKEKA GLFKL+E YL+ANPDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 8. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 173.6 bits 809,  Expect = 2e-45
 Identities = 119/159 74%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+EFTSVIPP +LF AF+LDADNLIPK+AP AVK  EILEGDGGVGTIKK+ FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS Y+YVKHR+DG+DK+N+ Y Y++IEGDA+S+ IE I+Y+ KLVAS   GS++K+TSH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YLL +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 9. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 171.8 bits 800,  Expect = 8e-45
 Identities = 118/159 74%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+EFTSVIPP +LF AF+LDADNLIPK+AP AVK  EILEGDGGVGTIKK+ FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS Y+YVKHR+DG+DKDN+ Y Y++IEGDA+S+ IE I+Y+ KLVA+   GS++K+TSH
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YLL + DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 170.5 bits 794,  Expect = 2e-44
 Identities = 118/159 74%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETEFTSVIPP +LF AF+LDADNLIPK+AP AVK  EILEGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS Y+YVKHR+DG+DK+N+ Y Y++IEGDA+S+ IE I+Y+ KLVAS   GS++K+TSH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTK DVEIKEE+VKAGKEKA+ LFKL+E YLLA+ DAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 169.7 bits 790,  Expect = 3e-44
 Identities = 117/159 73%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE EFTSVIPP +L+ AF+LDADNLIPK+AP AVK TEILEGDGGVGTIKK+ FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS Y+YVKH++DG+DKDN+ Y Y++IEGDA+S+ IE I+Y+ KLVAS   GS++K+ SH
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YLL + DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 169.3 bits 788,  Expect = 4e-44
 Identities = 116/159 72%, Positives = 139/159 87%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 169.3 bits 788,  Expect = 4e-44
 Identities = 116/159 72%, Positives = 139/159 87%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 168.9 bits 786,  Expect = 6e-44
 Identities = 117/160 73%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+E T+VI P +LFKAF+LDADNLIPKVAP A+K +EI+EG GG GTIKK+TFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQ+ YVKHR+D ID  N++Y+ TLIEGDA+S+ +E IAY+IKLVASPDGGSI+K+TS 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD EIKE+Q+KAGKE+A+G+FK VEAYLLANP AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 15. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 168.5 bits 784,  Expect = 8e-44
 Identities = 115/159 72%, Positives = 139/159 87%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KL+AS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 168.3 bits 783,  Expect = 9e-44
 Identities = 115/159 72%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFK F+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 168.1 bits 782,  Expect = 1e-43
 Identities = 115/159 72%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GT KK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 168.1 bits 782,  Expect = 1e-43
 Identities = 115/159 72%, Positives = 139/159 87%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA GLFKL+E++L  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 19. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 168.1 bits 782,  Expect = 1e-43
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYETE TSVIPP +LFKAF+LDADNLIPKV P AVK +EI+EG+GG GTIKK+ FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR D ID+ N++Y+Y++IEGDAL+D IE I+Y+ K+VAS +GGSI+K+ SH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YH+KGD EIKEE VK GKEKA+GLFK VE YLLA+PDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 20. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 167.7 bits 780,  Expect = 1e-43
 Identities = 115/159 72%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+V AGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 166.9 bits 776,  Expect = 2e-43
 Identities = 116/159 72%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IENI+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 166.7 bits 775,  Expect = 3e-43
 Identities = 115/158 72%, Positives = 137/158 86%, Gaps = 1/158 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GV+TYE E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            GSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SHY
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            HTKGDVEI EE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 23. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 166.5 bits 774,  Expect = 3e-43
 Identities = 116/159 72%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG++T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHRVD ID+ + SY+YTLIEGDAL+D IE I+Y+ KLVAS   GS +K+ SH
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD+EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 165.9 bits 771,  Expect = 5e-43
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 165.4 bits 769,  Expect = 7e-43
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 165.4 bits 769,  Expect = 7e-43
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+TYE EFTS IP  KLFKAF+LDADNLIPK+AP AVK  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVKH++  IDK+N +YSY+LIEGDALSD IE I Y+ KLV++P GG+++KTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +P  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 27. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 165.4 bits 769,  Expect = 7e-43
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+TYE EFTS IP  KLFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVKH++  IDK+N +YSY+LIEGDALSD IE I Y+ KLV++P GG+I+KTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +P  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 28. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 164.8 bits 766,  Expect = 1e-42
 Identities = 113/160 70%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFT+E E TS IPP +LFKAF+LDADNLIPK+AP A+K  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQ+ YVKHR+D ID+ N++Y Y++IEGD +++++E I+Y+IK+VASPDGGSI+K TS 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ EIKEE+V AGKEKAAGLFK VEAYLLA+ DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 164.6 bits 765,  Expect = 1e-42
 Identities = 114/159 71%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 164.4 bits 764,  Expect = 1e-42
 Identities = 114/159 71%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VK GKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 31. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 164.2 bits 763,  Expect = 2e-42
 Identities = 115/159 72%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 32. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 164.0 bits 762,  Expect = 2e-42
 Identities = 117/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+TYE EFTS IP  KLFKAF+LDADNLIPK+AP AVK  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVKH++  IDK N +YSY+LIEGDALS+ IE I Y+ KLV++P GG+I+KTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKAA LFKL+E YL  +P  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 33. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 163.6 bits 760,  Expect = 2e-42
 Identities = 113/159 71%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VKAGK KA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 163.6 bits 760,  Expect = 2e-42
 Identities = 115/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG +TYE EFTS IP  KLFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVKH++  IDK+N +YSY+LIEGDALSD IE I Y+ KLV++P GG+I+KTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +P  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 35. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 163.2 bits 758,  Expect = 3e-42
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG++EIKEE+VK GKEKA GLFKL+E+YL  +PDAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 36. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 162.2 bits 753,  Expect = 6e-42
 Identities = 112/159 70%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA   G +I K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YH KG++EIKEE+VK GKEK  GLFKL+E+YL  +PDAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 37. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 161.6 bits 750,  Expect = 9e-42
 Identities = 116/159 72%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+TYE EFTS IP  KLFKAF+LDADNLIPK+AP AVK  EILEGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVKH++  IDK+N +YSY+LIEGDALSD IE I Y+ KLV++P G +I+KTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +P  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 156.1 bits 723,  Expect = 4e-40
 Identities = 108/160 67%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIPP +LFK F+LD+DNLIPKVAP A+K  EI+EG+GG GTIKK+ F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + Y+K++V+ ID+ N+SY Y++IEGDALSD +E I Y+IK+VASP GGSI+K+ S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHT GD E+K+EQ+KAGKEKA+GLFK VE YLLA+ DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 151.8 bits 702,  Expect = 8e-39
 Identities = 102/159 64%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+E  SVIPP +LFKAF+LD+DNLIPKV P A+K TEI+EG+GG GTIKK+TFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+  + KHR+D ID +N++YS+++IEGDAL D +EN++ + K+VASPDGGSIVK+TS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            Y+TKGD ++ +E ++ GKEKA+ +FK VEAYL+A+PD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 40. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 150.8 bits 697,  Expect = 2e-38
 Identities = 103/160 64%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVI P +LFK+F+LDADNLIPKVAP  V   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS++ Y+KHRVD ID  N+ Y Y++IEG  L D +E I+Y+IK+VA+P GGSI+K TS 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD+ + EE++KAGKEK AGLFK VE YL+A+P+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 41. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 149.6 bits 691,  Expect = 4e-38
 Identities = 99/159 62%, Positives = 133/159 83%, Gaps = 0/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV  YE+E  SVIPP +LFKAF+LD+DNLIPKV P A+K TEI+EG+GG GTIKK+TFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+  + KHR+D ID +N+++S+++IEGDAL D +EN++ + K+VASPDGGSIVK+T  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            Y+TKGD ++ +E ++ GKEKA+G+FK VEAYL+A+PD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 42. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 147.9 bits 683,  Expect = 1e-37
 Identities = 103/159 64%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF+YE E TSVIPP +LFK+F+LDADNLIPKVAP    G E LEG+GG GTIKK+TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGG-SIVKTTS 119
            EGS++ Y+KH+V+ ID  N+ Y Y++IEG  L   +E I+Y+IK+ A+P GG SI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
             YHTKG+  I EE++KAGKEKAAGLFK VEAYLLA+PD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 147.3 bits 680,  Expect = 2e-37
 Identities = 103/159 64%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIPP +LFK+F+LDADNLIPKVAP    G E LEG+GG GTIKK+TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGG-SIVKTTS 119
            EGS++ Y+KH+V+ ID  N+ Y Y++IEG  L   +E I+Y+IK+ A+P GG SI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
             YHTKG+  I EE++KAGKEKAAGLFK VEAYLLA+PD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 44. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 146.3 bits 675,  Expect = 4e-37
 Identities = 101/159 63%, Positives = 132/159 83%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV+ YE++ TSVIPP +LFKAF+LD+DNLI KV P AVK TEI+EG+GG GTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E S+  Y KHR+D +D +N SYS+++IEG+AL+D I +I+ ++K+VASPDGGSI+K+T+ 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            Y+TKG  ++KEEQ++A  EK  GLFK VEAYLLA+PD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 45. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 146.1 bits 674,  Expect = 4e-37
 Identities = 102/159 64%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF+YE E TSVIPP +LFK+F+LDADNLIPKVAP      E LEG+GG GTIKK+TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGG-SIVKTTS 119
            EG+++ Y+KH+V+ ID  N+ Y Y++IEG  L   +E I Y+IK+ A+P GG SI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
             YHTKG+  I EE++KAGKEKAAGLFK VEAYLLA+PDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 46. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 145.9 bits 673,  Expect = 5e-37
 Identities = 98/159 61%, Positives = 133/159 83%, Gaps = 0/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFT+E++ TSVI P +LFKA+ LD+DNLI KV P A+K TEI+EG+GG GTIKK+TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+  + KHR+D ID +N++YS+++IEGDAL D +EN++ + K+VASPDGGSI K+TS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            Y+TKGD ++ +E ++ GKEKA+G+FK VEAYL+A+PD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 47. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 145.9 bits 673,  Expect = 5e-37
 Identities = 102/159 64%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIPP +LFK+F+LDADNLIPKVAP      E LEG+GG GTIKK+TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGG-SIVKTTS 119
            EG+++ Y+KH+V+ ID  N+ Y Y++IEG  L   +E I+Y+IK+ A+P GG SI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
             YHTKG+  I EE++KAGKEKAAGLFK VEAYLLA+PDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 145.5 bits 671,  Expect = 7e-37
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNLIPKVAP A+   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IKLVA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K E++KA KEKA  L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 145.3 bits 670,  Expect = 8e-37
 Identities = 99/158 62%, Positives = 135/158 85%, Gaps = 1/158 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFT+E++ TSVI P +LFKA+ LD+DNLI KV P A+K TEI+EG+GG GTIKK+TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E S++ Y KHR+D +D +N +YS+++IEGDAL+ V+E+++ +IK VASPDGGSI+K+T+ 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            Y+TKGD ++KEEQ++A  EKAAGL+K VEAYL+A+PD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 50. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 144.5 bits 666,  Expect = 1e-36
 Identities = 102/157 64%, Positives = 125/157 79%, Gaps = 0/157 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV TY+ E  S +PP KL+KAFILD D L+PKV P A+K  +ILEGDG  GTIK+VTFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS++  VK+RVD IDKDNL+YSYT+IEGD L++  E+I+Y IK+VA PDGGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPD 157
            Y TKGD ++ EE++K GKEKAA +FK +EAYLLANPD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 51. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 144.5 bits 666,  Expect = 1e-36
 Identities = 101/160 63%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD +NLIPKVAP AV   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RV+ +D  N+ YSYT+IEG  + D +E I  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+  E++K GKEK  GLF+ VEAYLLA+ DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 143.7 bits 662,  Expect = 2e-36
 Identities = 95/160 59%, Positives = 132/160 82%, Gaps = 1/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFTYE+EFTS I P +LFKAF+LD DNL+PK+AP AV+  EILEG+GGVGTIKK+TFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDAL-SDVIENIAYDIKLVASPDGGSIVKTTS 119
            +G  + YVKH+++ IDK++L+YSY++IEGDAL  + +E I ++ KLVAS DGG+++KT S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  HYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
             Y++ GD ++ EE+VK G+++A  ++K VEAYL  +P+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 53. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 143.5 bits 661,  Expect = 3e-36
 Identities = 97/158 61%, Positives = 132/158 83%, Gaps = 1/158 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV T+E++ TSVIPP +LFKAF+LD+DNLIPKV P A+K  E +EG+GG GTIKK+TFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E S++ Y KHR+D +D +N +YS+++IEGDAL+D++ +++ +IK+VASPDGGSI K+T+ 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            Y+TKGD ++KEEQ++A  EK  GL K VEAYLLA+PD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 54. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 143.3 bits 660,  Expect = 3e-36
 Identities = 100/160 62%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE+E TSVIP  +LFKAFILD DNLIPKVAP A+   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 142.9 bits 658,  Expect = 3e-36
 Identities = 98/137 71%, Positives = 120/137 87%, Gaps = 1/137 0%
Query  10   FTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGSQYAYVK 69
            +TSVIPP KLFKAF+LDADNLIPK+AP AVK  EI+EGDGGVGT+KK+ +GEG++++YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGDVEI 129
            H++DG+DK N+ YSY++ EGDAL D IE I+Y+IKLVAS   GSI+KTTSHYH KG  EI
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEI 119
Query  130  KEEQVKAGKEKAAGLFKL 147
            KEEQVK GKE+AAGLFK+
Sbjct  120  KEEQVKDGKERAAGLFKI 137

Sequence Alignment: 56. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 142.0 bits 654,  Expect = 7e-36
 Identities = 100/159 62%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YE+E TSVIP  +LFKAFILD DNLIPKVAP A+   E +EG+GG GTIKK+TF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            GS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IKLVA+PDGGSI+K ++ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            HTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 57. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 141.2 bits 650,  Expect = 1e-35
 Identities = 99/160 61%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFIL+ D LIPKVAP A+   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 140.8 bits 648,  Expect = 2e-35
 Identities = 98/160 61%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE+E TSVIP  +LFKAFIL+ D LIPKVAP A+   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 140.6 bits 647,  Expect = 2e-35
 Identities = 98/160 61%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE+E TSVIP  +LFKAFIL+ D LIPKVAP A+   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 140.4 bits 646,  Expect = 2e-35
 Identities = 97/160 60%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFKAFILD D L+PKVAP AV   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + YVK RVD +D+ N+ YS+++IEG A+ D +E +  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +HTKGD EI  EQ+K  KEKA GL+K VE+YLLA+ DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 140.2 bits 645,  Expect = 3e-35
 Identities = 96/160 60%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL+PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 139.4 bits 641,  Expect = 4e-35
 Identities = 96/156 61%, Positives = 121/156 77%, Gaps = 1/156 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG  TY+ E  S I  EK+FKAF+LD D +IPK  P A+ G + LEGDGGVGTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS +  VKHR+DG+DK+N++YSY++IEG AL DV E+I+Y IK+VA+PDGG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPD 157
            Y  K D ++ EE++KAGKE+A+G+FK VEAYLLANPD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 63. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 139.2 bits 640,  Expect = 5e-35
 Identities = 96/160 60%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 139.2 bits 640,  Expect = 5e-35
 Identities = 96/160 60%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 139.0 bits 639,  Expect = 6e-35
 Identities = 96/159 60%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YE E  SVIP  +LFKAFILD D L+PKVAP AV   E +EG+GG GTIKK+TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            GS + YVK RVD +D+ N+ YS+++IEG A+ D +E +  +IK+VA+PDGGSI+K ++ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            HTKGD EI  EQ+K  KEKA GL+K VE+YLLA+ DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 66. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 139.0 bits 639,  Expect = 6e-35
 Identities = 96/160 60%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 139.0 bits 639,  Expect = 6e-35
 Identities = 99/160 61%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  +LFKAFILD +NLIPKVAP AV   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS   YVK RV+ +D  N+ YSYT+IEG  + D +E I  +IK+VA+PDGGSI+K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+  E++K GKE+  GL+K VEAYLLA+   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 138.8 bits 638,  Expect = 7e-35
 Identities = 97/159 61%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            G  + YVK RVD +D  N+ YSY+LIEG  + D +E I+ +IK+VA+PDGGSI+K ++ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            HTKGD E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 69. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 138.8 bits 638,  Expect = 7e-35
 Identities = 96/160 60%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 138.6 bits 637,  Expect = 8e-35
 Identities = 96/160 60%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNLIPKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IKLVA+PDGGSI++ ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 137.8 bits 633,  Expect = 1e-34
 Identities = 95/160 59%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ YSY++IEG  + D +E I+ +IK+VA+P+GGSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQ+KA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 137.6 bits 632,  Expect = 2e-34
 Identities = 95/160 59%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ YSY++IEG  + D +E I+ +IK+VA+P+GGSI+K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQ+KA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 137.4 bits 631,  Expect = 2e-34
 Identities = 93/160 58%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D++E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 136.5 bits 627,  Expect = 3e-34
 Identities = 93/160 58%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 136.5 bits 627,  Expect = 3e-34
 Identities = 94/160 58%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ YSY++IEG  + D +E I+ +IK+VA+P+GGSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQ+KA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 136.3 bits 626,  Expect = 4e-34
 Identities = 93/160 58%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 136.3 bits 626,  Expect = 4e-34
 Identities = 97/160 60%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  +LFKAFILD + LIPKV+P AV   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS   YVK RV+ +D  N+ YSYT+IEG  + D +E I  +IK+VA+PDGGSI+K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+  E++K GKE+  GL+K VEAYLLA+   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 78. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 135.5 bits 622,  Expect = 7e-34
 Identities = 94/160 58%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +   N+ YSY++IEG  + D +E I+ +IK+VA+PDG SI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKGD E+K EQ+KA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 135.5 bits 622,  Expect = 7e-34
 Identities = 92/160 57%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  +LFKAFILD DNL+PKVAP A+   E +EG+GG GTIKK+ F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 80. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 135.1 bits 620,  Expect = 9e-34
 Identities = 92/160 57%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE+E TSVIP  +LFKAFIL+ DNLIPKVAP A+   E +EG+GG GTIKK+ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 81. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 134.7 bits 618,  Expect = 1e-33
 Identities = 91/160 56%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVK RVD +D  N++YSYT+IEGD L D +E + +++K+VA+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 82. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 134.7 bits 618,  Expect = 1e-33
 Identities = 91/160 56%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  ++FKAFILD D L+PKVAP A+   E +EG+GG GTIKK+ F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 83. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 134.7 bits 618,  Expect = 1e-33
 Identities = 92/160 57%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
             G  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 84. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 132.9 bits 609,  Expect = 4e-33
 Identities = 90/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVK RVD +D  N++YSYT+IEGD L D +E + +++K+VA+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 85. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 131.7 bits 603,  Expect = 1e-32
 Identities = 90/160 56%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVK RVD +D  N+ YSYT+IEGD L D +E +  ++K+VA+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 86. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 131.5 bits 602,  Expect = 1e-32
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            GS+Y YVK RVD +D  N++YSYT+IEGD L D +E + +++K+VA+P GGSI+K +S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 87. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 131.3 bits 601,  Expect = 1e-32
 Identities = 91/150 60%, Positives = 116/150 77%, Gaps = 0/150 0%
Query  4    FTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGS 63
            F YE+E TSVIP  +LFKAFIL+ DNLIPKVAP A+   E +EG+GG GTIKK+TF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHT 123
             + YVK RVD +D  N+ YSY++IEG AL D +E I  +IK+VA+PDGGSI+K ++ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDVEIKEEQVKAGKEKAAGLFKLVEAYLL 153
            KGD E+K E++KA KEK   L++ VE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 88. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 129.4 bits 592,  Expect = 5e-32
 Identities = 86/160 53%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+ D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 89. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 129.4 bits 592,  Expect = 5e-32
 Identities = 86/160 53%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+ D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 128.8 bits 589,  Expect = 7e-32
 Identities = 86/160 53%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+ D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 127.4 bits 582,  Expect = 2e-31
 Identities = 85/160 53%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 127.4 bits 582,  Expect = 2e-31
 Identities = 85/160 53%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 127.2 bits 581,  Expect = 2e-31
 Identities = 84/160 52%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGS+VK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 127.0 bits 580,  Expect = 2e-31
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YE E TSVIP  +LFKAFILD + LIPKV+P AV   E +EG+GG GTIKK+TF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            GS   YVK RV+ ID  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            H KG  E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 95. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 126.8 bits 579,  Expect = 3e-31
 Identities = 85/160 53%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 126.6 bits 578,  Expect = 3e-31
 Identities = 84/160 52%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 97. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 126.6 bits 578,  Expect = 3e-31
 Identities = 85/160 53%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG  + +VK RVD +D  N+ YSYT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 98. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 126.4 bits 577,  Expect = 4e-31
 Identities = 87/160 54%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVI   +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS+Y YVK RVD +D  N+ YSYT+IEGD L D +E +  ++K+VA+P GGS +K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 99. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 126.2 bits 576,  Expect = 4e-31
 Identities = 84/160 52%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 124.5 bits 568,  Expect = 1e-30
 Identities = 85/150 56%, Positives = 111/150 74%, Gaps = 0/150 0%
Query  4    FTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGS 63
            F YETE TSVIP  +LFKAFILD DNL PKVAP A+   + +EG+GG GTIKK+ F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHT 123
             + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG I+K ++ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDVEIKEEQVKAGKEKAAGLFKLVEAYLL 153
            KG+ E+K EQVKA KE    L++ VE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 101. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 124.3 bits 567,  Expect = 2e-30
 Identities = 83/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ +SYT+IEGD L D +E ++ ++K+VA+P GGSI+K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 123.7 bits 564,  Expect = 2e-30
 Identities = 83/159 52%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            GS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            H KG  E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 122.3 bits 557,  Expect = 6e-30
 Identities = 81/160 50%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVF YE E  SV+P  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS + +VK RVD +D  N+ +SYT+IEGD L D +E ++ ++ +VA+P GGSI+K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 104. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 121.1 bits 551,  Expect = 1e-29
 Identities = 81/159 50%, Positives = 112/159 70%, Gaps = 0/159 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVF YE E  SVIP  +LFK+++LD D LIPKVAP  +   E + G+GG GTIK +TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
            G  + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            H KG  E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 105. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 120.9 bits 550,  Expect = 2e-29
 Identities = 84/159 52%, Positives = 110/159 69%, Gaps = 0/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV T+  E T+ I P +LFK ++LD D+L+PK+    VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG    Y+KH++  ID  NL   Y+LIEGD L D +E+IAYD+K+ A+ DGG + KTT+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            YHTKGD  + EE+   GK KA  LFK +EAYLLANP  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 118.2 bits 537,  Expect = 1e-28
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 0/159 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV TY  E T+ I P +LFKA++LD DNL+PK+    VK  E +EGDGGVG+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG    Y+KH++  ID  NL   Y+LIEGD L + +E+I YDIK+ A+ +GG + KTT+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            YHTKGD  + EE+   G+E+   + K VEAYLLANP  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 117.2 bits 532,  Expect = 2e-28
 Identities = 84/158 53%, Positives = 111/158 70%, Gaps = 2/158 1%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFT+E E  S + P  L+KA++ DADN+IPK A  + K  E +EG+GG GTIKK+TF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E  +  +V H+++ ID+ NL YSY+++ G AL D  E I +D KLVA P+GGS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160
            Y TKGD E  ++++K GK KA  LFK +EAYLLA+PD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 114.8 bits 520,  Expect = 1e-27
 Identities = 77/156 49%, Positives = 107/156 68%, Gaps = 0/156 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GG GTIKK++F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E  +  +V H+++ ID+ NL YSY+++ G AL +  E I +D KL   P+GGS++K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156
            YH+KGD    E+++KAGK K+  LFK VEAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 113.3 bits 513,  Expect = 3e-27
 Identities = 76/155 49%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
            GVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GG GTIKK++F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
              +  +V H+++ ID+ NL YSY+++ G AL +  E I +D KL   P+GGS++K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156
            H+KGD    E+++KAGK K+  LFK VEAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 113.3 bits 513,  Expect = 3e-27
 Identities = 77/155 49%, Positives = 110/155 70%, Gaps = 1/155 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            M VFT+E + TS + P  L+KA++ DAD ++PK A  + K  EI+EG+GG GTIKK++F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E  +  +V H+++ ID+ NL YSY+++ G AL D  E I+ D KL   P+GGS+VK +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156
            YH+KGD    E+++KAGK K+  LFK++EAYLLANP
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 111.9 bits 506,  Expect = 8e-27
 Identities = 78/157 49%, Positives = 108/157 68%, Gaps = 2/157 1%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGVFT+E E TS +PP KL+ A + DAD++ PK+    VK  EI+EG+GG GTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E  +  ++ H+V+ ID+ N +Y+Y+++ G AL    E I ++ KLV  P+GGSI K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159
            YHTKGD +  EE++K GK K  GLF+ +E Y+LANP  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 107.9 bits 486,  Expect = 1e-25
 Identities = 75/155 48%, Positives = 105/155 67%, Gaps = 1/155 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            M VFT++ + TS + P  L+ A+  DADN+IPK A  + +  EI+EG+GG GTIKK++F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E  +  +V H+++ +D+ NL YSY+++ G AL D  E I  D K+    DGGS++K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156
            YH KGD    E+++KAGK K+  LFK VEAYLLANP
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 107.6 bits 485,  Expect = 2e-25
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV   E   TS +P  KLFKA+ LD D L+P+V P A+KG EILEGDGGVGT+K VT+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            + S Y  +K+++D IDK+ +++SY++I+GD L   I++I   + +V + DGG    +T+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            ++TKGD  + EE +K   ++   +FK VEAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 114. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 106.8 bits 481,  Expect = 3e-25
 Identities = 77/154 50%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV     E  S +  EK+++ F+LD D + PKV P  +K  EILEGDGGVGT+K V +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E ++Y  +K++VD IDK  L+Y+YT I GD L DV+E++  +  +V   DGG IVK T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            Y+TKGD  + E+++K   EK+A  FK VEAYLLAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 104.6 bits 470,  Expect = 1e-24
 Identities = 76/154 49%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV   E E  S +  EK+++ F+LD D + PKV P  +K  EILEGDGGVGT++ V +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E ++Y  +K++VD IDK  L Y+YT I GD L + +E++     +V   DGG IVK T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            Y+TKGD  + E++VK   EK+A  FK VEAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 104.2 bits 468,  Expect = 2e-24
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV T+  E+TS +  EK+F+ F++D D ++PK AP A K  EI +GDGG GT+K +T+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            +G     +  R+DG++K+ L++ Y++I+GD L   IE+I   + LV + DGGSI KTT+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + EE +K   E+   LFK +EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 117. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 104.0 bits 467,  Expect = 2e-24
 Identities = 71/146 48%, Positives = 98/146 67%, Gaps = 0/146 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV TY  E T+ I P +LFKA++LD DNL+PK+    VK  E +EGDGGVG+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EG    Y+KH++  ID  NL   Y+LIEGD L + +E+I YDIK+ A+ +GG + KTT+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFK 146
            YHTKGD  + EE+   G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 118. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 102.2 bits 458,  Expect = 7e-24
 Identities = 69/153 45%, Positives = 106/153 69%, Gaps = 2/153 1%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MGV T+E E TS +PP KLFKA ++D D L PK+ P A++  EI+EG+GG GT+KKVT  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            E  + +YV H++D ID+   +Y YT+  G  + +++E +++  KL A+ DGGS +K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + +E  +  K+K+ G+FK +E Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 99.7 bits 446,  Expect = 4e-23
 Identities = 64/152 42%, Positives = 97/152 63%, Gaps = 0/152 0%
Query  7    ETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGSQYA 66
            E E TS + P  +FKAF++D D + PK  P   K  + +EGDGGVGTIK +T+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGD 126
              KH+VD ID +N+S SYT+ EGD L  +IE+  + +K++ S DGGS+ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  VEIKEEQVKAGKEKAAGLFKLVEAYLLANPDA 158
             ++ +E V   KE     FK +E Y++++P+A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 99.1 bits 443,  Expect = 6e-23
 Identities = 68/154 44%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG  ++  E TS +  EK+F   +LD D +IPK AP A K  ++ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS    +  R D ++K+ L+Y  T+I+GD L   IE+I   + +V + DGGSI KTT+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + EE +K   E+   LFK +EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 98.5 bits 440,  Expect = 9e-23
 Identities = 68/154 44%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG  ++  E TS +  EK+F   +LD D +IPK AP A K  E+ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS    +  R D ++K+ L+Y  T+I+GD L   IE+I   + +V + DGGSI KTT+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + EE +K    +   LFK +EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 98.3 bits 439,  Expect = 1e-22
 Identities = 67/154 43%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG  ++  E TS +  EK+F   +LD D +IPK AP A K  ++ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS    +  R D ++K+ L+Y  T+I+GD L + IE+I   + +V + DGGSI KTT+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + EE +K    +   LFK +EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 97.9 bits 437,  Expect = 2e-22
 Identities = 67/154 43%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG  ++  E TS +  EK+F   +LD D +IPK AP A K  ++ +GDGG GT++ +T+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS    +  R D ++K+ L+Y  T+I+GD L + IE+I   + +V + DGGSI KTT+ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + EE +K    +   LFK +EAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 96.9 bits 432,  Expect = 3e-22
 Identities = 68/154 44%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
            MG  ++  E TS +  EK+F   +LD D +IPK A  A K  E+ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
            EGS    +  R D ++K+ LSY  T+I+GD L   IE+I   + +V + DGGSI KTT+ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155
            +HTKGD  + EE +K    +   LFK +EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 78.0 bits 339,  Expect = 9e-17
 Identities = 73/100 73%, Positives = 85/100 85%, Gaps = 39/100 39%
Query  22   AFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGSQYAYVKHRVDGIDKDNLS 81
            AF+LDADNLIPK                      K+TFGEGSQY YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKA 141
                 +EGDALSD +E I Y+ KLV++P   +I+KTTS YHTKGDVEIKEE+VKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  AGLFKLVEAYLLANPDAYN 160
            A LFKL+E YL  +P  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 52.3 bits 212,  Expect = 2e-09
 Identities = 32/49 65%, Positives = 41/49 83%, Gaps = 0/49 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGG 50
            GVFT+E++ TSVI P +LFKA+ LD+DNLI KV P A+K TEI+EG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 44.1 bits 173,  Expect = 2e-06
 Identities = 41/146 28%, Positives = 66/146 45%, Gaps = 3/146 2%
Query  4    FTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGS 63
            F  +TE++  +  E L+  +  D   ++PKV P  VK  +++EGDGGVGTI    F    
Sbjct  5    FNTQTELSVRL--EALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
Query  64   QYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHT 123
              +Y +  +   D+ +      +IEG  L+  +       KL    +  ++V     Y  
Sbjct  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
Query  124  KGDVEIKEEQVKAGKEKAAGLFKLVEAYL 152
              D+E K    K  +     L +L E YL
Sbjct  123  DSDIEEKVTPTKTSQSTLMYLRRL-ERYL 150

Sequence Alignment: 128. Allergen Name: Act d 11.0101 Sequence ID: P85524

 Score = 36.2 bits 134,  Expect = 0.0005
 Identities = 25/98 25%, Positives = 53/98 54%, Gaps = 2/98 2%
Query  30   LIPKVAPTAVKGTEILEGD-GGVGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLIE 88
            LI +++P  ++G ++LEG+ G VG++    +    +    K  V+ ID++  S ++ ++E
Sbjct  30   LISEMSPVNIQGVDLLEGNWGTVGSVIFFKYTIDGKEKTAKDIVEAIDEETKSVTFKIVE 89
Query  89   GDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGDVE 128
            GD L ++ +     +++    +  S+  T  +   K DVE
Sbjct  90   GD-LMELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKEDVE 128

Sequence Alignment: 129. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.3 bits 118,  Expect = 0.0006
 Identities = 17/24 70%, Positives = 22/24 91%, Gaps = 0/24 0%
Query  2    GVFTYETEFTSVIPPEKLFKAFIL 25
            GVFT+E++ TSVIPP +LFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.