The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG
EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH
YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
APD76154 Jug r 5.0101 160 1029 211.0 1.3e-56
CAA96549 Cor a 1.0301 160 816 169.4 4.3e-44
ACJ23864 Fag s 1.0101 160 809 168.0 1.1e-43
CAD10374 Cas s 1 160 804 167.0 2.2e-43
Q2I6V8 Pru p 1.0101 160 799 166.1 4.3e-43
AAB01362 Mal d 1.0201 159 798 165.9 4.8e-43
AAD26545 Mal d 1.0202 159 798 165.9 4.8e-43
O24248 Pru av 1 160 797 165.7 5.6e-43
CAA96535 Mal d 1.0401 160 795 165.3 7.3e-43
AAO25113 Mal d 1.0304 159 794 165.1 8.3e-43
AAD26548 Mal d 1.0204 159 794 165.1 8.3e-43
AAD13683 Mal d 1.0206 159 793 164.9 9.5e-43
AAK13030 Mal d 1.0207 159 792 164.7 1.1e-42
AAD26547 Mal d 1.0203 159 792 164.7 1.1e-42
AAD26558 Mal d 1.0205 159 790 164.3 1.4e-42
O65200 Pyr c 1 159 786 163.5 2.5e-42
CAD32318 Mal d 1.0208 158 785 163.3 2.8e-42
AAD26546 Mal d 1.0103 159 783 162.9 3.7e-42
CAA96536 Mal d 1.0402 160 783 162.9 3.7e-42
O50001 Pru ar 1 160 782 162.7 4.3e-42
B6CQS9 Pru du 1.0101 160 782 162.7 4.3e-42
AAD29671 Mal d 1.0108 159 781 162.6 4.8e-42
AAD26552 Mal d 1.0104 159 780 162.4 5.5e-42
CAA96537 Mal d 1.0403 160 780 162.4 5.6e-42
CAA58646 Mal d 1.0101 159 779 162.2 6.3e-42
CAA96534 Mal d 1.0301 159 779 162.2 6.3e-42
AAK13027 Mal d 1.0302 159 778 162.0 7.3e-42
AAD26555 Mal d 1.0107 159 777 161.8 8.3e-42
AAK13028 Mal d 1.0303 159 776 161.6 9.5e-42
AAD26554 Mal d 1.0106 159 775 161.4 1.1e-41
AAD26553 Mal d 1.0105 159 775 161.4 1.1e-41
CAA88833 Mal d 1.0102 159 773 161.0 1.4e-41
AAK13029 Mal d 1.0109 159 773 161.0 1.4e-41
ABZ81046 Que a 1.0301 160 769 160.2 2.5e-41
AUH28179 Que m 1.0101 160 758 158.1 1.1e-40
CAA54696.1 Bet v 1.0301 160 742 154.9 9.6e-40
ABZ81047 Que a 1.0401 160 735 153.6 2.5e-39
Q256S7 Fra a 1 160 733 153.2 3.2e-39
Q3T923 Fra a 1 160 733 153.2 3.2e-39
CAA96548 Cor a 1.0201 160 728 152.2 6.4e-39
Q256S2 Fra a 1 160 725 151.6 9.6e-39
AAD48405 Cor a 1.0401 161 725 151.6 9.6e-39
Q256S6 Fra a 1 160 724 151.4 1.1e-38
AAG40329 Cor a 1.0402 161 722 151.0 1.4e-38
AAG40331 Cor a 1.0404 161 722 151.0 1.4e-38
AAG40330 Cor a 1.0403 161 719 150.4 2.2e-38
Q39427 Bet v 1.0205 160 717 150.0 2.8e-38
Q256S4 Fra a 1 159 714 149.5 4.2e-38
P43186 Bet v 1.0204 160 712 149.1 5.6e-38
CAA54421 Bet v 1.0201 160 702 147.1 2.2e-37
CAB02160 Bet v 1.0113 160 702 147.1 2.2e-37
CAA04828.1 Bet v 1.0206 159 700 146.7 2.8e-37
P43184 Bet v 1.0203 160 699 146.5 3.2e-37
CAA50325 Cor a 1.0103 160 698 146.3 3.7e-37
CAA33887 Bet v 1.0101 160 697 146.1 4.2e-37
CAB02159 Bet v 1.0112 160 697 146.1 4.2e-37
CAB02156 Bet v 1.0109 160 696 145.9 4.9e-37
CAB02161 Bet v 1.0114 160 695 145.7 5.6e-37
CAA54487 Bet v 1.0106 160 694 145.6 6.4e-37
CAA54483 Bet v 1.0103 160 693 145.4 7.3e-37
CAA07329.1 Bet v 1.0118 160 693 145.4 7.3e-37
CAB02217 Car b 1.0302 161 692 145.2 8.4e-37
QOL10866 Que ac 1.0101 159 691 145.0 9.5e-37
CAA04827.1 Bet v 1.0116 159 691 145.0 9.5e-37
CAA54481 Bet v 1.0202 160 690 144.8 1.1e-36
AAB24432 Aln g 1 160 690 144.8 1.1e-36
CAA50327 Cor a 1.0101 160 689 144.6 1.3e-36
CAA54484 Bet v 1.0104 160 688 144.4 1.4e-36
CAA54482 Bet v 1.0102 160 687 144.2 1.6e-36
QGS84240 Que i 1.0101 159 685 143.8 2.1e-36
CAA54485 Bet v 1.0105 160 685 143.8 2.2e-36
CAA07323.1 Bet v 1.0117 160 684 143.6 2.5e-36
ABZ81045 Que a 1.0201 159 683 143.4 2.8e-36
P38948 Aln g 1 159 683 143.4 2.8e-36
CAB02155 Bet v 1.0108 160 683 143.4 2.8e-36
CAA54489 Bet v 1.0107 160 683 143.4 2.8e-36
Q08407 Cor a 1 159 682 143.2 3.2e-36
CAB02157 Bet v 1.0110 160 682 143.2 3.2e-36
CAB02216 Car b 1.0301 161 681 143.0 3.7e-36
CAA50328 Cor a 1.0102 160 679 142.6 4.9e-36
CAA96547 Bet v 1.0115 160 676 142.0 7.3e-36
CAB02158 Bet v 1.0111 160 675 141.8 8.4e-36
AFN42528 Can s 5.0101 161 674 141.6 9.6e-36
CAB02206 Car b 1.0103 160 670 140.9 1.6e-35
CAB02208 Car b 1.0105 160 667 140.3 2.5e-35
ABZ81040 Car b 1.0109 160 667 140.3 2.5e-35
CAB02207 Car b 1.0104 160 667 140.3 2.5e-35
ABZ81043 Car b 1.0112 160 663 139.5 4.2e-35
ADK39021 Ost c 1.0101 160 662 139.3 4.9e-35
ABZ81041 Car b 1.0110 160 662 139.3 4.9e-35
CAB02209 Car b 1.0106 160 660 138.9 6.4e-35
ABZ81042 Car b 1.0111 160 660 138.9 6.4e-35
ABZ81044 Car b 1.0113 160 657 138.3 9.6e-35
P38950 Car b 1 159 655 137.9 1.2e-34
CAB02213 Car b 1.0107 160 654 137.7 1.4e-34
CAA50326 Cor a 1.0104 160 653 137.5 1.6e-34
Q0Z8U9 Rub i 1.0101 137 646 136.2 3.7e-34
CAA47357 Car b 1.0102 159 645 136.0 4.8e-34
ACF75030.1 Bet v 1.0207 150 644 135.8 5.2e-34
CAB02215 Car b 1.0108 160 644 135.8 5.6e-34
P38949 Car b 1 159 629 132.8 4.2e-33
ABC41615.1 Bet v 1.0119 150 624 131.9 7.9e-33
CAM31908 Act c 8.0101 159 616 130.3 2.5e-32
NP_001275580 Sola l 4.0201 160 560 119.4 4.9e-29
CAM31909 Act d 8.0101 157 557 118.8 7.2e-29
CAA42646 Gly m 4 158 557 118.8 7.2e-29
AHC08073 Sola l 4.0101 160 552 117.8 1.4e-28
AAQ91847 Ara h 8.0101 157 551 117.6 1.6e-28
CAA43637 Pha v 1 156 541 115.7 6.2e-28
P25985 Pha v 1 155 534 114.3 1.6e-27
CAA43636 Pha v 1 155 527 112.9 4.1e-27
Q2VU97 Vig r 1.0101 155 518 111.2 1.4e-26
EF436550 Ara h 8.0201 153 515 110.6 2.1e-26
CAA75803 Lyc e 4.0101 178 488 105.3 9.3e-25
CAA67246 Pet c PR10 155 449 97.7 1.6e-22
P92918 Api g 1.0201 159 432 94.4 1.6e-21
AAL76932 Dau c 1.0201 154 428 93.6 2.7e-21
AAB92255 Tar o RAP 157 422 92.4 6.3e-21
P49372 Api g 1 154 406 89.3 5.4e-20
CAB03716 Dau c 1.0104 154 391 86.3 4.1e-19
CAB06416 Dau c 1.0105 154 388 85.8 6.1e-19
BAA13604 Dau c 1.0102 154 387 85.6 7e-19
AAB01092 Dau c 1.0101 168 385 85.2 1e-18
CAB03715 Dau c 1.0103 154 374 83.0 4.1e-18
Q5ULZ4 Fra a 1.0101 100 308 70.1 2.1e-14
P85126 Que a 1.0101 50 254 59.5 1.6e-11
Q9ZWP8 Vig r 6.0101 155 166 42.4 7.1e-06
Q9S8Q4 Cas s 1 24 131 35.4 0.00014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 211.0 bits 1029,  Expect = 1e-56
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 2. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 169.4 bits 816,  Expect = 4e-44
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIPPARLFK FVLD+DNLIPKV P+A+KS EIIEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS + Y+K++ + ID+ANF+Y YSVIEGDAL+DK+EKI+YE KIVAS  GGSILKSIS 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+ GDHE+K+E +K GKEKASGLFKAVEGYLLAH DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 168.0 bits 809,  Expect = 1e-43
 Identities = 121/160 75%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E+T+VI PARLFKAFVLDADNLIPKV PQA+KSSEIIEG+GGPGTIKKI FG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQ+ YVKHR D ID ANFTYA ++IEGDA+++ +EKI+YE K+VAS +GGSILKS S 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHEIKE+ +K GKE+ASG+FKAVE YLLA+P AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 4. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 167.0 bits 804,  Expect = 2e-43
 Identities = 123/160 76%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFT+E E TS IPP RLFKAFVLDADNLIPK+ P+A+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQ+KYVKHR D ID+ANFTY YSVIEGD + + +EKISYE KIVAS +GGSILK+ S 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG++EIKEE V  GKEKA+GLFKAVE YLLAH DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 166.1 bits 799,  Expect = 4e-43
 Identities = 119/160 74%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E TS IPP RLFKAFVLDADNL+PK+ PQA+K SEI+EG+GGPGTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D+ID+ N +Y+Y++IEGDAL D +EKISYETK+VAS  GGSI+KS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +E YL  HPDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 6. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 165.9 bits 798,  Expect = 5e-43
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 7. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 165.9 bits 798,  Expect = 5e-43
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 8. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 165.7 bits 797,  Expect = 6e-43
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E TS IPP RLFKAFVLDADNL+PK+ PQA+K SEI+EG+GGPGTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D+ID+ N++Y+Y++IEGDAL D +EKISYETK+VAS  GGSI+KS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKAS LFK +E YL  HPDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 9. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 165.3 bits 795,  Expect = 7e-43
 Identities = 118/160 73%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP  RLFKAF+LD DNLIPK+ PQA+KS+EIIEG+GG GTIKK+ FG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVK+R + ID+ NFTY+YS+IEGD L+DK+EKI+YETK++AS +GGSI+K+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKASGLFK +E YLLAH DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 165.1 bits 794,  Expect = 8e-43
 Identities = 122/159 76%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E TSVIPPARLF AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS Y YVKHR D +D+ NF Y YSVIEGDA+++ IEKISYETK+VAS   GS++KS SH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASG-SGSVIKSTSH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +E YLL HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 165.1 bits 794,  Expect = 8e-43
 Identities = 118/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK++AS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 164.9 bits 793,  Expect = 1e-42
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFK FVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 164.7 bits 792,  Expect = 1e-42
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGT KKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 164.7 bits 792,  Expect = 1e-42
 Identities = 118/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E +L  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 164.3 bits 790,  Expect = 1e-42
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE V  GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 163.5 bits 786,  Expect = 2e-42
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG++T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++YAY++IEGDAL D IEKISYE K+VAS   GS +KSISH
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 163.3 bits 785,  Expect = 3e-42
 Identities = 118/158 74%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GV+TYE E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            GSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISHY
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISHY 119
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KGD EI EE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 18. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 162.9 bits 783,  Expect = 4e-42
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 162.9 bits 783,  Expect = 4e-42
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE TSVIP  RLFKAF+LD DNLIPK+ PQA+KS++IIEG+GG GTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVK+R + ID+ NFTY+YS+IEGD L+DK+EKI+YETK++AS +GGSI+K+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKASGLFK +E YLLAH DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 20. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 162.7 bits 782,  Expect = 4e-42
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYETE TSVIPP +LFKAF+LDADNLIPKV P AVK +EI+EG+GG GTIKK+ FG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D ID+ N++Y+Y++IEGDAL+D IE I+Y+ K+VAS +GGSI+K+ SH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA+GLFK VE YLLA+PDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 21. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 162.7 bits 782,  Expect = 4e-42
 Identities = 114/160 71%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG+FTY  ESTSVIPP RLFKA+VL+AD LIPK+ PQ+VKS+EI+EG+GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+Y YVKH+ D +D+ NF Y YS++EGDAL+DK+EKISYE K+VAS +GGS++KS S+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEEDVK GKEKA+GLFK +E YL+A+PDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 22. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 162.6 bits 781,  Expect = 5e-42
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 162.4 bits 780,  Expect = 6e-42
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 162.4 bits 780,  Expect = 6e-42
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE TSVIP  RLFKAF+LD DNLIPK+ PQA+KS+EIIEG+GG GTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVK+R + ID+ NFTY+YS+IEGD L+DK+EKI+YETK++AS +GGSI+K+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            Y +KGD EIKEE VK GKEKASGLFK +E YLLAH DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 162.2 bits 779,  Expect = 6e-42
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 26. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 162.2 bits 779,  Expect = 6e-42
 Identities = 121/159 76%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE TSVIPPARLF AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS Y YVKHR D +D+ NF Y YSVIEGDA+++ IEKISYETK+VAS   GS++KS SH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASG-SGSVIKSTSH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+K D EIKEE VK GKEKAS LFK +E YLLAH DAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 27. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 162.0 bits 778,  Expect = 7e-42
 Identities = 120/159 75%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E TSVIPPARLF AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS Y YVKHR D +D+ NF Y YSVIEGDA+++ IEKISYETK+VA+   GS++KS SH
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +E YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 161.8 bits 777,  Expect = 8e-42
 Identities = 117/159 73%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GK KA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 161.6 bits 776,  Expect = 1e-41
 Identities = 120/159 75%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE E TSVIPPARL+ AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS Y YVKH+ D +D+ NF Y YSVIEGDA+++ IEKISYETK+VAS   GS++KSISH
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASG-SGSVIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +E YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 161.4 bits 775,  Expect = 1e-41
 Identities = 117/159 73%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IE ISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 31. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 161.4 bits 775,  Expect = 1e-41
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 32. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 161.0 bits 773,  Expect = 1e-41
 Identities = 117/159 73%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA   G +I KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH KG+ EIKEE VK GKEK  GLFK +E YL  HPDAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 33. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 161.0 bits 773,  Expect = 1e-41
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA    GS +KSISH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACG-SGSTIKSISH 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 34. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 160.2 bits 769,  Expect = 2e-41
 Identities = 116/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E  SVIPPARLFKAFVLD+DNLIPKVVPQA+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+ K+ KHR D ID  NFTY++SVIEGDAL DK+E +S ETKIVAS +GGSI+KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            Y++KGD ++ +E ++ GKEKAS +FKAVE YL+AHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 35. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 158.1 bits 758,  Expect = 1e-40
 Identities = 113/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV  YE+E  SVIPPARLFKAFVLD+DNLIPKVVPQA+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+ K+ KHR D ID  NFT+++SVIEGDAL DK+E +S ETKIVAS +GGSI+KS   
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            Y++KGD ++ +E ++ GKEKASG+FKAVE YL+AHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 36. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 154.9 bits 742,  Expect = 1e-39
 Identities = 113/160 70%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVI PARLFK+FVLDADNLIPKV P+ V S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS++KY+KHR D ID ANF Y YS+IEG  L D +EKISYE KIVA+  GGSILK  S 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD  + EE++K GKEK +GLFKAVE YL+AHP+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 37. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 153.6 bits 735,  Expect = 2e-39
 Identities = 111/159 69%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFT+E++ TSVI PARLFKA+ LD+DNLI KV+PQA+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+ K+ KHR D ID  NFTY++SVIEGDAL DK+E +S ETKIVAS +GGSI KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            Y++KGD ++ +E ++ GKEKASG+FKAVE YL+AHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 38. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 153.2 bits 733,  Expect = 3e-39
 Identities = 110/160 68%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+TYE E TS IP  +LFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL+D IEKI YETK+V++  GG+I+K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +EGYL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 39. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 153.2 bits 733,  Expect = 3e-39
 Identities = 110/160 68%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+TYE E TS IP  +LFKAFVLDADNLIPK+ PQAVK +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL+D IEKI YETK+V++  GG+++K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +EGYL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 40. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 152.2 bits 728,  Expect = 6e-39
 Identities = 109/160 68%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETESTSVIP ARLFKAF+LD +NLIPKV PQAV S E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R + +D  NF Y+Y+VIEG  + DK+EKI  E KIVA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+  E +K GKEK  GLF+AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 151.6 bits 725,  Expect = 1e-38
 Identities = 109/160 68%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+TYE E TS IP  +LFKAFVLDADNLIPK+ PQAVK +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL++ IEKI YETK+V++  GG+I+K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKA+ LFK +EGYL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 151.6 bits 725,  Expect = 1e-38
 Identities = 110/159 69%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIPPARLFK+FVLDADNLIPKV PQ   S+E +EGNGGPGTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVAS-HEGGSILKSIS 119
            EG+++KY+KH+ + ID ANF Y YS+IEG  L   +EKISYE K+ A+ H GGSILK  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
             YH+KG+  I EE++K GKEKA+GLFKAVE YLLAHPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 43. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 151.4 bits 724,  Expect = 1e-38
 Identities = 109/160 68%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG +TYE E TS IP  +LFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL+D IEKI YETK+V++  GG+I+K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +EGYL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 44. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 151.0 bits 722,  Expect = 1e-38
 Identities = 109/159 68%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF+YE E+TSVIPPARLFK+FVLDADNLIPKV PQ    +E +EGNGGPGTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVAS-HEGGSILKSIS 119
            EGS++KY+KH+ + ID ANF Y YS+IEG  L   +EKISYE K+ A+ H GGSILK  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
             YH+KG+  I EE++K GKEKA+GLFKAVE YLLAHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 151.0 bits 722,  Expect = 1e-38
 Identities = 109/159 68%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF+YE E+TSVIPPARLFK+FVLDADNLIPKV PQ   S+E +EGNGGPGTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVAS-HEGGSILKSIS 119
            EG+++KY+KH+ + ID ANF Y YS+IEG  L   +EKI YE K+ A+ H GGSILK  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  HYHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
             YH+KG+  I EE++K GKEKA+GLFKAVE YLLAHPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 46. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 150.4 bits 719,  Expect = 2e-38
 Identities = 109/159 68%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIPPARLFK+FVLDADNLIPKV PQ    +E +EGNGGPGTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVAS-HEGGSILKSIS 119
            EGS++KY+KH+ + ID ANF Y YS+IEG  L   +EKISYE K+ A+ H GGSILK  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
             YH+KG+  I EE++K GKEKA+GLFKAVE YLLAHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 150.0 bits 717,  Expect = 3e-38
 Identities = 110/160 68%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E K+VA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KEKA  L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 149.5 bits 714,  Expect = 4e-38
 Identities = 110/159 69%, Positives = 131/159 82%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+TYE E TS IP  +LFKAFVLDADNLIPK+ PQAVK +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL+D IEKI YETK+V++  G +I+K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD EIKEE VK GKEKAS LFK +EGYL  HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 149.1 bits 712,  Expect = 6e-38
 Identities = 109/160 68%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE+E+TSVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E KIVA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 147.1 bits 702,  Expect = 2e-37
 Identities = 108/160 67%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E KIVA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 51. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 147.1 bits 702,  Expect = 2e-37
 Identities = 107/160 66%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GGSILK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 146.7 bits 700,  Expect = 3e-37
 Identities = 107/159 67%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YE+E+TSVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            GS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E K+VA+ +GGSILK  + Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KGDHE+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 53. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 146.5 bits 699,  Expect = 3e-37
 Identities = 107/160 66%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE+E+TSVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E KIVA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 146.3 bits 698,  Expect = 4e-37
 Identities = 105/160 65%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+YKYVK R D +D  NFTY+Y+VIEGD L DK+EK+ +E KIVA+  GGSILK  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 146.1 bits 697,  Expect = 4e-37
 Identities = 107/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GGSILK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 146.1 bits 697,  Expect = 4e-37
 Identities = 107/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GGSILK  + 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 145.9 bits 696,  Expect = 5e-37
 Identities = 107/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GGSILK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 145.7 bits 695,  Expect = 6e-37
 Identities = 107/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GGSILK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 145.6 bits 694,  Expect = 6e-37
 Identities = 106/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y+YSVIEG  + D +EKIS E KIVA+  GGSILK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 145.4 bits 693,  Expect = 7e-37
 Identities = 106/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y+YSVIEG  + D +EKIS E KIVA+  GGSILK  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 145.4 bits 693,  Expect = 7e-37
 Identities = 106/160 66%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E K+VA+ +GGSIL+  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 145.2 bits 692,  Expect = 8e-37
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIP ARLFKAF+LD +NLIPKV PQAV S E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS  KYVK R + +D  NF Y+Y+VIEG  + DK+EKI  E KIVA+ +GGSILK  S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+  E +K GKE+  GL+K VE YLLAH   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 63. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 145.0 bits 691,  Expect = 1e-36
 Identities = 105/159 66%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV+ YE++ TSVIPPARLFKAFVLD+DNLI KV+P+AVKS+EIIEGNGGPGTIKK  FG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E S+ KY KHR D +D  N +Y++SVIEG+AL D I  IS E K VAS +GGSI+KS + 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            Y++KG  ++KEE ++   EK +GLFKAVE YLLAHPD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 64. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 145.0 bits 691,  Expect = 1e-36
 Identities = 106/159 66%, Positives = 123/159 77%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            G  +KYVK R D +D ANF Y+YS+IEG  + D +EKIS E KIVA+ +GGSILK  + Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KGDHE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 144.8 bits 690,  Expect = 1e-36
 Identities = 106/160 66%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE+E+TSVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E KIVA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGD+E+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 144.8 bits 690,  Expect = 1e-36
 Identities = 105/160 65%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFKAF+LD D L+PKV P+AV S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +KYVK R D +D  NF Y++SVIEG A+ D +EK+  E KIVA+ +GGSILK  + 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHEI  E +K  KEKA GL+KAVE YLLAH DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 144.6 bits 689,  Expect = 1e-36
 Identities = 104/160 65%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+YKYVK R D +D  NFTY+Y+VIEGD L DK+EK+ +E KIVA+  GGSILK  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 144.4 bits 688,  Expect = 1e-36
 Identities = 105/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y+YSVIEG  + D +EKIS E KIVA+  GGSILK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 144.2 bits 687,  Expect = 2e-36
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKINF 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 143.8 bits 685,  Expect = 2e-36
 Identities = 106/158 67%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV T+E++ TSVIPPARLFKAFVLD+DNLIPKV+PQA+KS E IEGNGGPGTIKKI FG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E S++KY KHR DA+D  N TY++SVIEGDAL D +  +S E K VAS +GGSI KS + 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            Y++KGD ++KEE ++   EK +GL KAVE YLLAHPD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 71. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 143.8 bits 685,  Expect = 2e-36
 Identities = 104/160 65%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE+E+TSVIP ARLFKAF+L+ DNLIPKV PQA+ S E IEGNGGPGTIKKINF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 143.6 bits 684,  Expect = 2e-36
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 143.4 bits 683,  Expect = 3e-36
 Identities = 104/158 65%, Positives = 131/158 82%, Gaps = 1/158 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFT+E++ TSVI PARLFKA+ LD+DNLI KV+PQA+KS+EIIEGNGGPGTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E S++KY KHR DA+D  N TY++SVIEGDAL   +E +S E K VAS +GGSI+KS + 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            Y++KGD ++KEE ++   EKA+GL+KAVE YL+AHPD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 74. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 143.4 bits 683,  Expect = 3e-36
 Identities = 104/159 65%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YE E+ SVIP ARLFKAF+LD D L+PKV P+AV S E IEGNGGPGTIKKI F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            GS +KYVK R D +D  NF Y++SVIEG A+ D +EK+  E KIVA+ +GGSILK  + +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KGDHEI  E +K  KEKA GL+KAVE YLLAH DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 75. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 143.4 bits 683,  Expect = 3e-36
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 143.4 bits 683,  Expect = 3e-36
 Identities = 103/160 64%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP AR+FKAF+LD D L+PKV PQA+ S E IEGNGGPGTIKKINF 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 143.2 bits 682,  Expect = 3e-36
 Identities = 103/159 64%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            GS+YKYVK R D +D  NFTY+Y+VIEGD L DK+EK+ +E KIVA+  GGSILK  S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 78. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 143.2 bits 682,  Expect = 3e-36
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 143.0 bits 681,  Expect = 4e-36
 Identities = 103/160 64%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+TSVIP ARLFKAF+LD + LIPKV PQAV S E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS  KYVK R + +D  NF Y+Y+VIEG  + DK+EKI  E KIVA+ +GGSILK  S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+  E +K GKE+  GL+K VE YLLAH   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 80. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 142.6 bits 679,  Expect = 5e-36
 Identities = 103/160 64%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+YKYVK R D +D  NF Y+Y+VIEGD L DK+EK+  E KIVA+  GGSILK  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 81. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 142.0 bits 676,  Expect = 7e-36
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +KYVK R D +   NF Y+YSVIEG  + D +EKIS E KIVA+ +G SILK  + 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KGDHE+K E +K  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 82. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 141.8 bits 675,  Expect = 8e-36
 Identities = 103/160 64%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
             G  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 83. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 141.6 bits 674,  Expect = 1e-35
 Identities = 97/160 60%, Positives = 135/160 84%, Gaps = 1/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFTYE+E TS I PARLFKAFVLD DNL+PK+ PQAV+  EI+EGNGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDAL-ADKIEKISYETKIVASHEGGSILKSIS 119
            +G  +KYVKH+ +AID+ ++TY+YS+IEGDAL  +++EKI++E+K+VAS +GG+++K++S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  HYHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
             Y+S GD ++ EE VK+G+++A+ ++K VE YL  HP+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 84. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 140.9 bits 670,  Expect = 2e-35
 Identities = 100/160 62%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E +K  KE A  L++AVE YLLAH D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 140.3 bits 667,  Expect = 2e-35
 Identities = 100/160 62%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E +K  KE A  L++AVE YLLAH D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 86. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 140.3 bits 667,  Expect = 2e-35
 Identities = 100/160 62%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSILK  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 87. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 140.3 bits 667,  Expect = 2e-35
 Identities = 99/160 61%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L D +EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 88. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 139.5 bits 663,  Expect = 4e-35
 Identities = 99/160 61%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 89. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 139.3 bits 662,  Expect = 5e-35
 Identities = 99/160 61%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+   E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSILK  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 139.3 bits 662,  Expect = 5e-35
 Identities = 98/160 61%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGS++K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 138.9 bits 660,  Expect = 6e-35
 Identities = 99/160 61%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 138.9 bits 660,  Expect = 6e-35
 Identities = 99/160 61%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E +K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 138.3 bits 657,  Expect = 1e-34
 Identities = 98/160 61%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG  +K+VK R D +D ANF Y+Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 137.9 bits 655,  Expect = 1e-34
 Identities = 101/159 63%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YE E+TSVIP ARLFKAF+LD + LIPKV PQAV S E +EGNGGPGTIKKI F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            GS  KYVK R + ID  NF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KG HE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 95. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 137.7 bits 654,  Expect = 1e-34
 Identities = 98/160 61%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF ++Y+VIEGD L DK+EK+S E KIVA+  GGSILK    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 137.5 bits 653,  Expect = 2e-34
 Identities = 100/160 62%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SVI  ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I FG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS+YKYVK R D +D  NF Y+Y+VIEGD L DK+EK+  E KIVA+  GGS LK  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 97. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 136.2 bits 646,  Expect = 4e-34
 Identities = 97/135 71%, Positives = 116/135 85%, Gaps = 1/135 0%
Query  11   TSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGSQYKYVKH 70
            TSVIPP +LFKAFVLDADNLIPK+ PQAVKS EIIEG+GG GT+KKI++GEG+++ YVKH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHYHSKGDHEIK 130
            + D +D+ NF Y+YS+ EGDAL DKIEKISYE K+VAS  G SI+K+ SHYH KG  EIK
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEIK 120
Query  131  EEDVKDGKEKASGLFK 146
            EE VKDGKE+A+GLFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 98. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 136.0 bits 645,  Expect = 5e-34
 Identities = 97/159 61%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            GS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KG HE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 99. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 135.8 bits 644,  Expect = 5e-34
 Identities = 99/150 66%, Positives = 117/150 78%, Gaps = 0/150 0%
Query  4    FTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGS 63
            F YE+E+TSVIP ARLFKAF+L+ DNLIPKV PQA+ S E IEGNGGPGTIKKI F EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHYHS 123
             +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E KIVA+ +GGSILK  + YH+
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEIKEEDVKDGKEKASGLFKAVEGYLL 153
            KGDHE+K E +K  KEK   L++AVE YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 100. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 135.8 bits 644,  Expect = 6e-34
 Identities = 96/160 60%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVF YE E+ SV+P ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K+VK R D +D ANF ++Y+VIEGD L DK+EK+S E  IVA+  GGSILK    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 101. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 132.8 bits 629,  Expect = 4e-33
 Identities = 95/159 59%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVF YE E+ SVIP ARLFK++VLD D LIPKV PQ + S E + GNGGPGTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
            G  +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            H+KG HE+  E +K  KE A  L++AVE YLLAH   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 102. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 131.9 bits 624,  Expect = 8e-33
 Identities = 96/150 64%, Positives = 112/150 74%, Gaps = 0/150 0%
Query  4    FTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGS 63
            F YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S + IEGNGGPGTIKKINF EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHYHS 123
             +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG ILK  + YH+
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEIKEEDVKDGKEKASGLFKAVEGYLL 153
            KG+HE+K E VK  KE    L++AVE YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 103. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 130.3 bits 616,  Expect = 2e-32
 Identities = 91/157 57%, Positives = 125/157 79%, Gaps = 0/157 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV TY+ E  S +PP +L+KAF+LD D L+PKV+P+A+K  +I+EG+G  GTIK++ FG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS++K VK+R DAID+ N+TY+Y++IEGD LA+K E ISY  KIVA  +GGSI K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPD 157
            Y +KGD ++ EE++K GKEKA+ +FKA+E YLLA+PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 104. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 119.4 bits 560,  Expect = 5e-29
 Identities = 83/159 52%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV T+  EST+ I P RLFK +VLD D+L+PK++ + VKS EI+EG+GG G+IK++NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG   KY+KH+   ID+ N+   YS+IEGD L DK+E I+Y+ K  A+ +GG + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            YH+KGDH + EE+   GK KA  LFKA+E YLLA+P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 105. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 118.8 bits 557,  Expect = 7e-29
 Identities = 87/156 55%, Positives = 112/156 71%, Gaps = 1/156 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG  TY+ E  S I   ++FKAFVLD D +IPK +P+A+   + +EG+GG GTIK   FG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS +K VKHR D +D+ NFTY+YS+IEG AL D  E ISY  KIVA+ +GG I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPD 157
            Y  K D ++ EE++K GKE+ASG+FK VE YLLA+PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 106. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 118.8 bits 557,  Expect = 7e-29
 Identities = 88/158 55%, Positives = 115/158 72%, Gaps = 2/158 1%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFT+E E  S + PA L+KA+V DADN+IPK +  + KS E +EGNGGPGTIKKI F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E  + K+V H+ ++IDEAN+ Y+YSV+ G AL D  EKI++++K+VA   GGS  K    
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160
            Y +KGD E  ++++K GK KA  LFKA+E YLLAHPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 117.8 bits 552,  Expect = 1e-28
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV TY  EST+ I P RLFKA+VLD DNL+PK++ Q VK++E IEG+GG G+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG   KY+KH+   ID+ N+   YS+IEGD L +K+E I+Y+ K  A+  GG + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            YH+KGDH + EE+   G+E+   + KAVE YLLA+P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 117.6 bits 551,  Expect = 2e-28
 Identities = 84/157 53%, Positives = 114/157 72%, Gaps = 2/157 1%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFT+E E TS +PPA+L+ A + DAD++ PK++   VKS EI+EGNGGPGTIKK+   
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E  + K++ H+ ++IDEAN+ Y YSV+ G AL    EKI++ETK+V    GGSI K    
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159
            YH+KGD +  EE++K GK K  GLF+A+EGY+LA+P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 115.7 bits 541,  Expect = 6e-28
 Identities = 81/156 51%, Positives = 113/156 72%, Gaps = 0/156 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGVFT+E ++TS + PA L+KA   DAD + PK +P + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E  + K+V H+ ++IDEAN+ Y+YS++ G AL +  EKI++++K+     GGS++K    
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156
            YHSKGD    E+++K GK K+  LFKAVE YLLA+P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 114.3 bits 534,  Expect = 2e-27
 Identities = 80/155 51%, Positives = 112/155 72%, Gaps = 0/155 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
            GVFT+E ++TS + PA L+KA   DAD + PK +P + KS EI+EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
              + K+V H+ ++IDEAN+ Y+YS++ G AL +  EKI++++K+     GGS++K    Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156
            HSKGD    E+++K GK K+  LFKAVE YLLA+P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 112.9 bits 527,  Expect = 4e-27
 Identities = 81/155 52%, Positives = 111/155 71%, Gaps = 1/155 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            M VFT+E ++TS + PA L+KA+V DAD ++PK V  + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E  + K+V H+ + IDEAN+ Y+YS++ G AL D  EKIS ++K+     GGS++K    
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156
            YHSKGD    E+++K GK K+  LFK +E YLLA+P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 111.2 bits 518,  Expect = 1e-26
 Identities = 80/155 51%, Positives = 112/155 72%, Gaps = 1/155 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            M VFT++ ++TS + PA L+ A+  DADN+IPK V  + +S EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E  + K+V H+ +++DEAN+ Y+YS++ G AL D  EKI+ +TKI    +GGS++K    
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156
            YH KGD    E+++K GK K+  LFKAVE YLLA+P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 110.6 bits 515,  Expect = 2e-26
 Identities = 77/153 50%, Positives = 115/153 75%, Gaps = 2/153 1%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV T+E ESTS +PPA+LFKA V+D D L PK++P A++S EI+EGNGGPGT+KK+   
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E  +  YV H+ DAIDEA +TY Y++  G  + + +EK+S++TK+ A+ +GGS +K    
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + +E  +D K+K+ G+FKA+EGY+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 105.3 bits 488,  Expect = 9e-25
 Identities = 72/146 49%, Positives = 102/146 69%, Gaps = 0/146 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV TY  EST+ I P RLFKA+VLD DNL+PK++ Q VK++E IEG+GG G+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EG   KY+KH+   ID+ N+   YS+IEGD L +K+E I+Y+ K  A+  GG + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFK 146
            YH+KGDH + EE+   G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 97.7 bits 449,  Expect = 2e-22
 Identities = 68/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV   E   TS +P A+LFKA+ LD D L+P+V+P A+K  EI+EG+GG GT+K + +G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            + S YK +K++ DAID+  FT++YS+I+GD L   I+ I+     V + +GG    S + 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +++KGD  + EE++K   ++ + +FKAVE YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 94.4 bits 432,  Expect = 2e-21
 Identities = 64/154 41%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV     E+ S +   ++++ F+LD D + PKV+PQ +KS EI+EG+GG GT+K +++G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E ++Y  +K++ D ID+A + Y Y+ I GD L D +E +  E  +V + +GG I+K+ + 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            Y++KGD  + E+ +K+  EK++  FKAVE YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 93.6 bits 428,  Expect = 3e-21
 Identities = 63/154 40%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV   E E+ S +   ++++ F+LD D + PKV+PQ +KS EI+EG+GG GT++ +++G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            E ++Y  +K++ D ID+A + Y Y+ I GD L + +E +  +  +V + +GG I+K+ + 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            Y++KGD  + E+ VK+  EK++  FKAVE YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 92.4 bits 422,  Expect = 6e-21
 Identities = 64/152 42%, Positives = 95/152 62%, Gaps = 0/152 0%
Query  7    ETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGSQYK 66
            E E TS + P+ +FKAFV+D D + PK  P+  KS + IEG+GG GTIK I + +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHYHSKGD 126
              KH+ DAID  NF+ +Y++ EGD L   IE  ++  K + S +GGS+ K    +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEIKEEDVKDGKEKASGLFKAVEGYLLAHPDA 158
             ++ +E+V   KE     FKA+E Y+++HP+A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 89.3 bits 406,  Expect = 5e-20
 Identities = 64/154 41%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MGV T+  E TS +   ++F+ FV+D D ++PK  P A KS EI +G+GGPGT+K I + 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            +G     +  R D +++  +T+ YSVI+GD L   IE I     +V + +GGSI K+ + 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + EE++K   E+ + LFKA+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 86.3 bits 391,  Expect = 4e-19
 Identities = 62/154 40%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS    +  RTDA+++  +TY  +VI+GD L   IE I     +V + +GGSI K+ + 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + EE++K   E+ + LFKA+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 85.8 bits 388,  Expect = 6e-19
 Identities = 62/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK  P A KS E+ +G+GG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS    +  RTDA+++  +TY  +VI+GD L   IE I     +V + +GGSI K+ + 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + EE++K    + + LFKA+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 85.6 bits 387,  Expect = 7e-19
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS    +  RTDA+++  +TY  +VI+GD L + IE I     +V + +GGSI K+ + 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + EE++K    + + LFKA+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 85.2 bits 385,  Expect = 1e-18
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ I + 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS    +  RTDA+++  +TY  +VI+GD L + IE I     +V + +GGSI K+ + 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + EE++K    + + LFKA+E YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 83.0 bits 374,  Expect = 4e-18
 Identities = 60/154 38%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK    A KS E+ +G+GG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
            EGS    +  RTDA+++  ++Y  +VI+GD L   IE I     +V + +GGSI K+ + 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155
            +H+KGD  + EE++K    + + LFKA+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 70.1 bits 308,  Expect = 2e-14
 Identities = 69/100 69%, Positives = 81/100 81%, Gaps = 39/100 39%
Query  22   AFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGSQYKYVKHRTDAIDEANFT 81
            AFVLDADNLIPK                      KI FGEGSQY YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHYHSKGDHEIKEEDVKDGKEKA 141
                 +EGDAL+D +EKI YETK+V++    +I+K+ S YH+KGD EIKEE VK GKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  SGLFKAVEGYLLAHPDAYN 160
            + LFK +EGYL  HP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 59.5 bits 254,  Expect = 2e-11
 Identities = 38/50 76%, Positives = 46/50 92%, Gaps = 0/50 0%
Query  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGP 51
            GVFT+E++ TSVI PARLFKA+ LD+DNLI KV+PQA+KS+EIIEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 42.4 bits 166,  Expect = 7e-06
 Identities = 43/125 34%, Positives = 63/125 50%, Gaps = 9/125 7%
Query  24   VLDAD--NLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGSQYKYVKHRTDAIDEANFT 81
            VL  D   ++PKV+P+ VK  ++IEG+GG GTI   NF       Y +      DE++  
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YAYSVIEGDALADKIEKISYETKIVASHEGGSILK-SISHYHSKGDHEIKEEDVKDGKEK 140
                VIEG  L   +       K+    E  +++   IS+ H   D +I EE V   K  
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH---DSDI-EEKVTPTKTS 136
Query  141  ASGL--FKAVEGYL 152
             S L  ++ +E YL
Sbjct  137  QSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 35.4 bits 131,  Expect = 0.0001
 Identities = 20/24 83%, Positives = 23/24 95%, Gaps = 0/24 0%
Query  2    GVFTYETESTSVIPPARLFKAFVL 25
            GVFT+E++ TSVIPPARLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.