The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV
EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE
YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA
Sequence Info Allergen Name Length Opt Bits Score E Value
AHC08073 Sola l 4.0101 160 1030 218.5 6.8e-59
CAA75803 Lyc e 4.0101 178 898 191.7 9.1e-51
NP_001275580 Sola l 4.0201 160 862 184.4 1.3e-48
ACJ23864 Fag s 1.0101 160 556 122.2 6.7e-30
APD76154 Jug r 5.0101 160 552 121.4 1.2e-29
B6CQS9 Pru du 1.0101 160 541 119.2 5.5e-29
O50001 Pru ar 1 160 537 118.4 9.7e-29
AAG40329 Cor a 1.0402 161 530 116.9 2.6e-28
AAG40330 Cor a 1.0403 161 527 116.3 4e-28
AAG40331 Cor a 1.0404 161 524 115.7 6.1e-28
AAD48405 Cor a 1.0401 161 524 115.7 6.1e-28
Q2I6V8 Pru p 1.0101 160 522 115.3 8.1e-28
O24248 Pru av 1 160 517 114.3 1.6e-27
CAD10374 Cas s 1 160 517 114.3 1.6e-27
CAA54696.1 Bet v 1.0301 160 515 113.9 2.2e-27
CAA96549 Cor a 1.0301 160 510 112.9 4.4e-27
AAO25113 Mal d 1.0304 159 505 111.9 8.8e-27
CAA96535 Mal d 1.0401 160 504 111.7 1e-26
ABZ81046 Que a 1.0301 160 504 111.7 1e-26
QGS84240 Que i 1.0101 159 497 110.2 2.7e-26
Q256S2 Fra a 1 160 496 110.0 3.1e-26
Q3T923 Fra a 1 160 496 110.0 3.1e-26
Q256S7 Fra a 1 160 494 109.6 4.2e-26
ABZ81047 Que a 1.0401 160 493 109.4 4.8e-26
AFN42528 Can s 5.0101 161 493 109.4 4.8e-26
AUH28179 Que m 1.0101 160 492 109.2 5.5e-26
AAK13027 Mal d 1.0302 159 490 108.8 7.3e-26
CAB02217 Car b 1.0302 161 490 108.8 7.4e-26
CAA96536 Mal d 1.0402 160 489 108.6 8.4e-26
CAA96537 Mal d 1.0403 160 489 108.6 8.4e-26
AAK13028 Mal d 1.0303 159 487 108.2 1.1e-25
CAA96534 Mal d 1.0301 159 487 108.2 1.1e-25
CAA96548 Cor a 1.0201 160 486 108.0 1.3e-25
Q256S6 Fra a 1 160 485 107.8 1.5e-25
CAA54482 Bet v 1.0102 160 485 107.8 1.5e-25
CAB02216 Car b 1.0301 161 485 107.8 1.5e-25
CAM31908 Act c 8.0101 159 479 106.6 3.4e-25
Q39427 Bet v 1.0205 160 478 106.4 4e-25
CAA54485 Bet v 1.0105 160 477 106.2 4.6e-25
AAD26548 Mal d 1.0204 159 475 105.8 6e-25
Q256S4 Fra a 1 159 475 105.8 6e-25
CAB02209 Car b 1.0106 160 475 105.8 6e-25
AAD26545 Mal d 1.0202 159 474 105.6 6.9e-25
AAB01362 Mal d 1.0201 159 474 105.6 6.9e-25
CAA54489 Bet v 1.0107 160 474 105.6 7e-25
P43186 Bet v 1.0204 160 474 105.6 7e-25
CAA07323.1 Bet v 1.0117 160 473 105.4 8e-25
AAD26558 Mal d 1.0205 159 472 105.2 9.2e-25
CAB02155 Bet v 1.0108 160 472 105.2 9.2e-25
CAB02157 Bet v 1.0110 160 471 105.0 1.1e-24
CAB02160 Bet v 1.0113 160 471 105.0 1.1e-24
AAD13683 Mal d 1.0206 159 469 104.5 1.4e-24
CAA04828.1 Bet v 1.0206 159 469 104.5 1.4e-24
CAB02208 Car b 1.0105 160 469 104.5 1.4e-24
AAD26547 Mal d 1.0203 159 468 104.3 1.6e-24
AAK13030 Mal d 1.0207 159 468 104.3 1.6e-24
CAB02213 Car b 1.0107 160 468 104.3 1.6e-24
CAD32318 Mal d 1.0208 158 467 104.1 1.8e-24
ABZ81045 Que a 1.0201 159 466 103.9 2.1e-24
P38950 Car b 1 159 466 103.9 2.1e-24
CAA54484 Bet v 1.0104 160 466 103.9 2.1e-24
CAA54487 Bet v 1.0106 160 465 103.7 2.5e-24
CAB02158 Bet v 1.0111 160 464 103.5 2.8e-24
CAA33887 Bet v 1.0101 160 464 103.5 2.8e-24
CAA54483 Bet v 1.0103 160 464 103.5 2.8e-24
CAB02161 Bet v 1.0114 160 464 103.5 2.8e-24
CAB02159 Bet v 1.0112 160 464 103.5 2.8e-24
ABZ81041 Car b 1.0110 160 464 103.5 2.8e-24
ABZ81040 Car b 1.0109 160 463 103.3 3.3e-24
ABZ81043 Car b 1.0112 160 463 103.3 3.3e-24
CAB02156 Bet v 1.0109 160 463 103.3 3.3e-24
ADK39021 Ost c 1.0101 160 462 103.1 3.8e-24
CAA07329.1 Bet v 1.0118 160 462 103.1 3.8e-24
P43184 Bet v 1.0203 160 461 102.9 4.3e-24
CAA54421 Bet v 1.0201 160 461 102.9 4.3e-24
QOL10866 Que ac 1.0101 159 459 102.5 5.7e-24
CAA04827.1 Bet v 1.0116 159 459 102.5 5.7e-24
ABZ81044 Car b 1.0113 160 459 102.5 5.8e-24
ABZ81042 Car b 1.0111 160 458 102.3 6.6e-24
CAB02215 Car b 1.0108 160 458 102.3 6.6e-24
AAK13029 Mal d 1.0109 159 457 102.1 7.6e-24
CAA58646 Mal d 1.0101 159 457 102.1 7.6e-24
CAB02206 Car b 1.0103 160 457 102.1 7.6e-24
CAB02207 Car b 1.0104 160 456 101.9 8.8e-24
AAD26546 Mal d 1.0103 159 454 101.5 1.2e-23
AAD26554 Mal d 1.0106 159 453 101.3 1.3e-23
O65200 Pyr c 1 159 453 101.3 1.3e-23
CAA50325 Cor a 1.0103 160 453 101.3 1.3e-23
AAB24432 Aln g 1 160 453 101.3 1.3e-23
AAD26553 Mal d 1.0105 159 452 101.1 1.5e-23
AAD29671 Mal d 1.0108 159 452 101.1 1.5e-23
CAA54481 Bet v 1.0202 160 452 101.1 1.5e-23
CAA50327 Cor a 1.0101 160 451 100.9 1.8e-23
AAD26552 Mal d 1.0104 159 450 100.7 2e-23
CAA88833 Mal d 1.0102 159 450 100.7 2e-23
CAA96547 Bet v 1.0115 160 450 100.7 2e-23
CAA50328 Cor a 1.0102 160 449 100.5 2.4e-23
AAD26555 Mal d 1.0107 159 448 100.3 2.7e-23
P38948 Aln g 1 159 446 99.9 3.6e-23
CAM31909 Act d 8.0101 157 445 99.7 4e-23
CAA47357 Car b 1.0102 159 445 99.7 4.1e-23
ABC41615.1 Bet v 1.0119 150 444 99.5 4.4e-23
Q08407 Cor a 1 159 444 99.5 4.7e-23
CAA50326 Cor a 1.0104 160 442 99.1 6.3e-23
ACF75030.1 Bet v 1.0207 150 439 98.5 8.9e-23
P38949 Car b 1 159 434 97.4 1.9e-22
CAA43637 Pha v 1 156 432 97.0 2.5e-22
P25985 Pha v 1 155 425 95.6 6.7e-22
CAA42646 Gly m 4 158 421 94.8 1.2e-21
Q0Z8U9 Rub i 1.0101 137 411 92.8 4.1e-21
CAA43636 Pha v 1 155 412 93.0 4.2e-21
AAQ91847 Ara h 8.0101 157 400 90.5 2.3e-20
AAB92255 Tar o RAP 157 399 90.3 2.6e-20
Q2VU97 Vig r 1.0101 155 397 89.9 3.4e-20
CAA67246 Pet c PR10 155 396 89.7 4e-20
P92918 Api g 1.0201 159 384 87.3 2.2e-19
EF436550 Ara h 8.0201 153 382 86.9 2.8e-19
AAL76932 Dau c 1.0201 154 381 86.7 3.2e-19
P49372 Api g 1 154 358 82.0 8.3e-18
BAA13604 Dau c 1.0102 154 335 77.3 2.1e-16
CAB03715 Dau c 1.0103 154 333 76.9 2.8e-16
CAB03716 Dau c 1.0104 154 333 76.9 2.8e-16
AAB01092 Dau c 1.0101 168 333 76.9 3.1e-16
CAB06416 Dau c 1.0105 154 330 76.3 4.3e-16
Q5ULZ4 Fra a 1.0101 100 194 48.8 5.4e-08
P85126 Que a 1.0101 50 174 44.9 4e-07
Q9ZWP8 Vig r 6.0101 155 169 43.6 3e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 218.5 bits 1030,  Expect = 7e-59
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA 160
            YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA 160

Sequence Alignment: 2. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 191.7 bits 898,  Expect = 9e-51
 Identities = 138/138 100%, Positives = 138/138 100%, Gaps = 0/138 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHVVSEEEHNVGR 138
            YHTKGDHVVSEEEHNVGR
Sbjct  121  YHTKGDHVVSEEEHNVGR 138

Sequence Alignment: 3. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 184.4 bits 862,  Expect = 1e-48
 Identities = 130/160 81%, Positives = 147/160 91%, Gaps = 0/160 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGVNT+T+ESTTTI+PTRLFK LVLDFD+LVPKLLS+ VK+ E +EGDGG GSIKQMNFV
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EGGPIKYLKHKIHVIDDKNL TKYSLIEGD+LG+KLESI YD+KFEA  +GGCV KTTTE
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA 160
            YHTKGDHVVSEEEHNVG+ + +++ KA+EAYLLANPSVYA
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA 160

Sequence Alignment: 4. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 122.2 bits 556,  Expect = 7e-30
 Identities = 84/159 52%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E+TT I+P RLFKA+VLD DNL+PK+  Q +K++E IEG GG G+IK++ F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ N+    +LIEGD + E LE I Y+IK+ A+ +GG + K+T++
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH + E++   G+E    I KAVEAYLLANP+ Y
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159

Sequence Alignment: 5. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 121.4 bits 552,  Expect = 1e-29
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  EST+ I P RLFKA+VLD DNL+PK++ Q VK++E IEG+GG G+IK++NF 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+KH+   ID+ N+   YS+IEGD L +K+E I+Y+ K  A+  GG + K+ + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YH+KGDH + EE+   G+E+   + KAVE YLLA+P  Y
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159

Sequence Alignment: 6. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 119.2 bits 541,  Expect = 6e-29
 Identities = 81/159 50%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG+ TYT EST+ I P RLFKALVL+ D L+PK+  Q VK+ E +EGDGGVG+IK+++F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  +D  N+   YSL+EGD L +K+E I+Y+IK+ A+ +GG V K+T+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE+   G+E+   + K +E YL+ANP  Y
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY 159

Sequence Alignment: 7. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 118.4 bits 537,  Expect = 1e-28
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I P +LFKA++LD DNL+PK+    VK  E +EGDGGVG+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH++  ID  NL   Y+LIEGD L + +E+I YDIK+ A+ +GG + KTT+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE+   G+E+   + K VEAYLLANP  Y
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159

Sequence Alignment: 8. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 116.9 bits 530,  Expect = 3e-28
 Identities = 81/159 50%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV +Y  E+T+ I P RLFK++VLD DNL+PK+  QH    E +EG+GG G+IK++ F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGG-CVYKTTT 119
            EG   KY+KHK+  ID  N++  YS+IEG  LG  LE I+Y+IK  A  +GG  + K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +YHTKG+  +SEEE   G+E+   + KAVEAYLLA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 9. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 116.3 bits 527,  Expect = 4e-28
 Identities = 81/159 50%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I P RLFK++VLD DNL+PK+  QH    E +EG+GG G+IK++ F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGG-CVYKTTT 119
            EG   KY+KHK+  ID  N++  YS+IEG  LG  LE I+Y+IK  A  +GG  + K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +YHTKG+  +SEEE   G+E+   + KAVEAYLLA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 10. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 115.7 bits 524,  Expect = 6e-28
 Identities = 80/159 50%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV +Y  E+T+ I P RLFK++VLD DNL+PK+  QH  + E +EG+GG G+IK++ F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGG-CVYKTTT 119
            EG   KY+KHK+  ID  N++  YS+IEG  LG  LE I Y+IK  A  +GG  + K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +YHTKG+  ++EEE   G+E+   + KAVEAYLLA+P  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 11. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 115.7 bits 524,  Expect = 6e-28
 Identities = 80/159 50%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I P RLFK++VLD DNL+PK+  QH  + E +EG+GG G+IK++ F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGG-CVYKTTT 119
            EG   KY+KHK+  ID  N++  YS+IEG  LG  LE I+Y+IK  A  +GG  + K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +YHTKG+  ++EEE   G+E+   + KAVEAYLLA+P  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 12. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 115.3 bits 522,  Expect = 8e-28
 Identities = 80/159 50%, Positives = 108/159 67%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I P RLFKA+VLD DNLVPK+  Q +K++E +EGDGG G+IK++ F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  ID +N    Y+LIEGD LG+ LE I+Y+ K+ A+ +GG + K+T+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  N+ K +E YL  +P  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 13. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 114.3 bits 517,  Expect = 2e-27
 Identities = 79/159 49%, Positives = 108/159 67%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I P RLFKA+VLD DNLVPK+  Q +K++E +EGDGG G+IK++ F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  ID +N    Y+LIEGD LG+ LE I+Y+ K+ A+ +GG + K+T+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+E+  N+ K +E YL  +P  Y
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 14. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 114.3 bits 517,  Expect = 2e-27
 Identities = 80/159 50%, Positives = 112/159 70%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PKL  + +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+KH+I  ID  N+   YS+IEGD++ E LE I+Y+IK  A+ +GG + K T++
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG++ + EE+   G+E+   + KAVEAYLLA+   Y
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY 159

Sequence Alignment: 15. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 113.9 bits 515,  Expect = 2e-27
 Identities = 78/159 49%, Positives = 112/159 70%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I+P RLFK++VLD DNL+PK+  ++V + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+KH++  ID  N++  YS+IEG  LG+ LE I+Y+IK  A   GG + K T++
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  ++EEE   G+E+   + KAVE YL+A+P+ Y
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY 159

Sequence Alignment: 16. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 112.9 bits 510,  Expect = 4e-27
 Identities = 76/159 47%, Positives = 109/159 68%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I P RLFK +VLD DNL+PK+  + +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P  Y+K+K+  ID  N+  +YS+IEGD L +KLE I Y+IK  A+ +GG + K+ ++
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHT GDH + +E+   G+E+   + KAVE YLLA+   Y
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 111.9 bits 505,  Expect = 9e-27
 Identities = 78/158 49%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  +D +N+  KYS+IEGD + E +E I+Y+ K+ A+ +G  V K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YLL +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158

Sequence Alignment: 18. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 111.7 bits 504,  Expect = 1e-26
 Identities = 77/159 48%, Positives = 108/159 67%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q +K+ E IEGDGGVG+IK++ F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+K++++ ID  N+   YS+IEGD L +KLE ITY+ K+ A+ +GG + KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YH KGD  + EE    G+E+   + K +EAYLLA+   Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 19. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 111.7 bits 504,  Expect = 1e-26
 Identities = 76/159 47%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E  + I P RLFKA+VLD DNL+PK++ Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG  +K+ KH+I VID +N+   +S+IEGD L +KLE+++ + K  A+ +GG + K+T++
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y+TKGD  +++E    G+E+   + KAVEAYL+A+P +Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 20. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 110.2 bits 497,  Expect = 3e-26
 Identities = 78/158 49%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV+T+  + T+ I P RLFKA+VLD DNL+PK+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E    KY KH+I  +D +N    +S+IEGD L + + S++ +IKF A+ +GG + K+TT+
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y+TKGD  + EE+     E+I  +SKAVEAYLLA+P +Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 110.0 bits 496,  Expect = 3e-26
 Identities = 79/159 49%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKIH ID  N    YSLIEGD L E +E I Y+ K+ +  +GG + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 110.0 bits 496,  Expect = 3e-26
 Identities = 79/159 49%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +GG V KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 23. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 109.6 bits 494,  Expect = 4e-26
 Identities = 77/159 48%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q +K  E +EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +GG + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 24. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 109.4 bits 493,  Expect = 5e-26
 Identities = 75/159 47%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG  +K+ KH+I VID +N+   +S+IEGD L +KLE+++ + K  A+ +GG + K+T++
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y+TKGD  +++E    G+E+   + KAVEAYL+A+P +Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 25. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 109.4 bits 493,  Expect = 5e-26
 Identities = 80/159 50%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T++I+P RLFKA+VLD DNLVPK+  Q V+  E +EG+GGVG+IK++ F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDIL-GEKLESITYDIKFEANDNGGCVYKTTT 119
            +G P KY+KHKI  ID ++L   YS+IEGD L G +LE IT++ K+ A+ +GG V KT +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  EYHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +Y++ GD  V+EE+   G ++   + K VEAYL  +P  Y
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAY 160

Sequence Alignment: 26. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 109.2 bits 492,  Expect = 6e-26
 Identities = 75/159 47%, Positives = 112/159 70%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E  + I P RLFKA+VLD DNL+PK++ Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG  +K+ KH+I VID +N+   +S+IEGD L +KLE+++ + K  A+ +GG + K+T +
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y+TKGD  +++E    G+E+   + KAVEAYL+A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 27. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 108.8 bits 490,  Expect = 7e-26
 Identities = 77/158 48%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  +D  N+  KYS+IEGD + E +E I+Y+ K+ A  +G  V K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGS-VIKSTSH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YLL +   Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158

Sequence Alignment: 28. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 108.8 bits 490,  Expect = 7e-26
 Identities = 73/159 45%, Positives = 108/159 67%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD +NL+PK+  Q V + E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P+KY+K ++  +D  N++  Y++IEG  +G+K+E I  +IK  A  +GG + K T++
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E    G+ER+  + K VEAYLLA+ + Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 108.6 bits 489,  Expect = 8e-26
 Identities = 75/159 47%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E T+ I   RLFKA++LD DNL+PK+  Q +K+ + IEGDGGVG+IK++ F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+K++++ ID  N+   YS+IEGD L +KLE ITY+ K+ A+ +GG + KT + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YH KGD  + EE    G+E+   + K +EAYLLA+   Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 108.6 bits 489,  Expect = 8e-26
 Identities = 76/159 47%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E T+ I   RLFKA++LD DNL+PK+  Q +K+ E IEGDGGVG+IK++ F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+K++++ ID  N+   YS+IEGD L +KLE ITY+ K+ A+ +GG + KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y  KGD  + EE    G+E+   + K +EAYLLA+   Y
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 31. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 108.2 bits 487,  Expect = 1e-25
 Identities = 75/158 47%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY +E T+ I P RL+ A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D  N+  +YS+IEGD + E +E I+Y+ K+ A+ +G  V K+ + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGS-VIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YLL +   Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAY 158

Sequence Alignment: 32. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 108.2 bits 487,  Expect = 1e-25
 Identities = 76/158 48%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  +D +N+  KYS+IEGD + E +E I+Y+ K+ A+ +G  V K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTK D  + EE    G+E+  ++ K +E YLLA+   Y
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158

Sequence Alignment: 33. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 108.0 bits 486,  Expect = 1e-25
 Identities = 72/159 45%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  EST+ I   RLFKA++LD +NL+PK+  Q V + E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  Y++IEG  +G+K+E I  +IK  A  +GG + K + +
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E    G+E++  + +AVEAYLLA+   Y
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAY 159

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 107.8 bits 485,  Expect = 1e-25
 Identities = 76/159 47%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  TY  E T+ I   +LFKA+VLD DNL+PK+  Q +K  E +EGDGG G+IK++ F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +GG + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 35. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 107.8 bits 485,  Expect = 1e-25
 Identities = 74/159 46%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNLVPK+  Q + + E IEG+GG G+IK++NF 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 36. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 107.8 bits 485,  Expect = 1e-25
 Identities = 72/159 45%, Positives = 107/159 67%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD + L+PK+  Q V + E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P+KY+K ++  +D  N++  Y++IEG  +G+K+E I  +IK  A  +GG + K T++
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E    G+ER+  + K VEAYLLA+ + Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 37. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 106.6 bits 479,  Expect = 3e-25
 Identities = 76/156 48%, Positives = 106/156 67%, Gaps = 0/156 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E  + + P +L+KA++LD D LVPK+L + +K  + +EGDG  G+IK++ F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   K +K+++  ID  NL   Y++IEGD+L EK+ESI+Y IK  A  +GG + K  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            Y TKGD  VSEEE  +G+E+   I KA+EAYLLANP
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 38. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 106.4 bits 478,  Expect = 4e-25
 Identities = 71/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK+ A  +GG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAY 159

Sequence Alignment: 39. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 106.2 bits 477,  Expect = 5e-25
 Identities = 72/159 45%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++L+ DNL+PK+  Q + + E IEG+GG G+IK++NF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 40. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 105.8 bits 475,  Expect = 6e-25
 Identities = 71/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 41. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 105.8 bits 475,  Expect = 6e-25
 Identities = 77/158 48%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +G  + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158

Sequence Alignment: 42. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 105.8 bits 475,  Expect = 6e-25
 Identities = 66/159 41%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLDFD L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 43. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 105.6 bits 474,  Expect = 7e-25
 Identities = 71/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 44. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 105.6 bits 474,  Expect = 7e-25
 Identities = 71/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 45. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 105.6 bits 474,  Expect = 7e-25
 Identities = 72/159 45%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   R+FKA++LD D LVPK+  Q + + E IEG+GG G+IK++NF 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 46. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 105.6 bits 474,  Expect = 7e-25
 Identities = 71/159 44%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 105.4 bits 473,  Expect = 8e-25
 Identities = 72/159 45%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 48. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 105.2 bits 472,  Expect = 9e-25
 Identities = 71/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 49. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 105.2 bits 472,  Expect = 9e-25
 Identities = 72/159 45%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 50. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 105.0 bits 471,  Expect = 1e-24
 Identities = 72/159 45%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 105.0 bits 471,  Expect = 1e-24
 Identities = 72/159 45%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNLVPK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 52. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 104.5 bits 469,  Expect = 1e-24
 Identities = 70/158 44%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFK +VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 53. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 104.5 bits 469,  Expect = 1e-24
 Identities = 70/158 44%, Positives = 103/158 65%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q + + E IEG+GG G+IK++ F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK+ A  +GG + K + +Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            HTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 54. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 104.5 bits 469,  Expect = 1e-24
 Identities = 65/159 40%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLDFD L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ E+    +E    + +AVE+YLLA+   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 55. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 104.3 bits 468,  Expect = 2e-24
 Identities = 70/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E++L  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAY 158

Sequence Alignment: 56. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 104.3 bits 468,  Expect = 2e-24
 Identities = 70/158 44%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+ K++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 57. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 104.3 bits 468,  Expect = 2e-24
 Identities = 66/159 41%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLDFD L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE ++ ++K  A   GG + K + +
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 58. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 104.1 bits 467,  Expect = 2e-24
 Identities = 71/157 45%, Positives = 103/157 65%, Gaps = 1/157 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV TY  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISHY 119
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            HTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAY 157

Sequence Alignment: 59. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 103.9 bits 466,  Expect = 2e-24
 Identities = 74/158 46%, Positives = 108/158 68%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E    KY KH+I  +D +N    +S+IEGD L   +ES++ +IK  A+ +GG + K+TT+
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y+TKGD  + EE+     E+   + KAVEAYL+A+P +Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 60. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 103.9 bits 466,  Expect = 2e-24
 Identities = 67/158 42%, Positives = 107/158 67%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+T+ I   RLFKA++LD + L+PK+  Q V + E +EG+GG G+IK++ F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G P+KY+K ++  ID  N++  Y++IEGD+LG+KLE +++++K  A   GG + K ++++
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            H KG H V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 61. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 103.9 bits 466,  Expect = 2e-24
 Identities = 72/159 45%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  NGG + K   +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 62. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 103.7 bits 465,  Expect = 2e-24
 Identities = 72/159 45%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  NGG + K   +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 63. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 103.5 bits 464,  Expect = 3e-24
 Identities = 71/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
             G P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 64. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 103.5 bits 464,  Expect = 3e-24
 Identities = 71/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 103.5 bits 464,  Expect = 3e-24
 Identities = 72/159 45%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  NGG + K   +
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 66. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 103.5 bits 464,  Expect = 3e-24
 Identities = 71/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAY 159

Sequence Alignment: 67. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 103.5 bits 464,  Expect = 3e-24
 Identities = 71/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GG + K + +
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 68. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 103.5 bits 464,  Expect = 3e-24
 Identities = 66/159 41%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG V K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 69. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 103.3 bits 463,  Expect = 3e-24
 Identities = 65/159 40%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 70. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 103.3 bits 463,  Expect = 3e-24
 Identities = 65/159 40%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 71. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 103.3 bits 463,  Expect = 3e-24
 Identities = 71/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 72. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 103.1 bits 462,  Expect = 4e-24
 Identities = 65/159 40%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q +   E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 73. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 103.1 bits 462,  Expect = 4e-24
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK+ A  +GG + + + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 74. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 102.9 bits 461,  Expect = 4e-24
 Identities = 69/159 43%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++L+ D L+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 75. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 102.9 bits 461,  Expect = 4e-24
 Identities = 69/159 43%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++L+ D L+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 76. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 102.5 bits 459,  Expect = 6e-24
 Identities = 73/158 46%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  + T+ I P RLFKA+VLD DNL+ K+L + VK+ E IEG+GG G+IK+  F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E   +KY KH+I  +D +N    +S+IEG+ L + + SI+ ++KF A+ +GG + K+TT+
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            Y+TKG   + EE+     E+   + KAVEAYLLA+P +Y
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158

Sequence Alignment: 77. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 102.5 bits 459,  Expect = 6e-24
 Identities = 71/158 44%, Positives = 103/158 65%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G P KY+K ++  +D  N++  YSLIEG  +G+ LE I+ +IK  A  +GG + K + +Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            HTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 78. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 102.5 bits 459,  Expect = 6e-24
 Identities = 65/159 40%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 79. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 102.3 bits 458,  Expect = 7e-24
 Identities = 64/159 40%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ E+    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 80. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 102.3 bits 458,  Expect = 7e-24
 Identities = 64/159 40%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + +   RLFK+ VLDFD L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE ++ ++   A   GG + K + +
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 102.1 bits 457,  Expect = 8e-24
 Identities = 70/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE   VG+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 82. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 102.1 bits 457,  Expect = 8e-24
 Identities = 70/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE   VG+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 83. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 102.1 bits 457,  Expect = 8e-24
 Identities = 64/159 40%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ E+    +E    + +AVE+YLLA+   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 84. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 101.9 bits 456,  Expect = 9e-24
 Identities = 64/159 40%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+ LE +++++K  A   GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 101.5 bits 454,  Expect = 1e-23
 Identities = 69/158 43%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 86. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 101.3 bits 453,  Expect = 1e-23
 Identities = 69/158 43%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E+I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 87. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 101.3 bits 453,  Expect = 1e-23
 Identities = 68/158 43%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG+ T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EG+GG G+IK++ F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH++  ID+ +    Y+LIEGD L + +E I+Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 88. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 101.3 bits 453,  Expect = 1e-23
 Identities = 66/159 41%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 89. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 101.3 bits 453,  Expect = 1e-23
 Identities = 66/159 41%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFKA++LD D L+PK+  + V + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  +S+IEG  +G+ LE +  +IK  A  +GG + K + +
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +HTKGDH ++ E+  + +E+ + + KAVE+YLLA+   Y
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 101.1 bits 452,  Expect = 2e-23
 Identities = 69/158 43%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 91. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 101.1 bits 452,  Expect = 2e-23
 Identities = 69/158 43%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 92. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 101.1 bits 452,  Expect = 2e-23
 Identities = 68/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++L+ D L+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD+ +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 93. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 100.9 bits 451,  Expect = 2e-23
 Identities = 65/159 40%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 100.7 bits 450,  Expect = 2e-23
 Identities = 69/158 43%, Positives = 102/158 64%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 95. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 100.7 bits 450,  Expect = 2e-23
 Identities = 69/158 43%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YH KG+  + EE   VG+E+   + K +E+YL  +P  Y
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 96. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 100.7 bits 450,  Expect = 2e-23
 Identities = 70/159 44%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG P KY+K ++  +  KN++  YS+IEG  +G+ LE I+ +IK  A  +G  + K + +
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 97. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 100.5 bits 449,  Expect = 2e-23
 Identities = 65/159 40%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+K ++  +D+ N++  Y++IEGD+LG+KLE +  ++K  A   GG + K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 100.3 bits 448,  Expect = 3e-23
 Identities = 68/158 43%, Positives = 102/158 64%, Gaps = 1/158 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKG+  + EE    G+ +   + K +E+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 99. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 99.9 bits 446,  Expect = 4e-23
 Identities = 65/158 41%, Positives = 104/158 65%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+ + I   RLFKA++LD D L+PK+  + V + E IEG+GG G+IK++ F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G P KY+K ++  +D  N++  +S+IEG  +G+ LE +  +IK  A  +GG + K + ++
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            HTKGDH ++ E+  + +E+ + + KAVE+YLLA+   Y
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 158

Sequence Alignment: 100. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 99.7 bits 445,  Expect = 4e-23
 Identities = 75/155 48%, Positives = 100/155 64%, Gaps = 1/155 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  TY  E  ++IS  ++FKA+VLD D ++PK L + +   +T+EGDGGVG+IK   F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   K +KH+I  +D +N+   YS+IEG  L + +ESI+Y IK  A  +GGC+ K  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            Y  K D  VSEEE   G+ER   I K VEAYLLANP
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 101. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 99.7 bits 445,  Expect = 4e-23
 Identities = 63/158 39%, Positives = 103/158 65%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K ++++
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            H KG H V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 102. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 99.5 bits 444,  Expect = 4e-23
 Identities = 66/148 44%, Positives = 99/148 66%, Gaps = 0/148 0%
Query  6    YTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVEGGPI 65
            Y  E+T+ I   RLFKA++LD DNL PK+  Q + + + IEG+GG G+IK++NF EG P 
Sbjct  3    YETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFPF 62
Query  66   KYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKG 125
            KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGC+ K + +YHTKG
Sbjct  63   KYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTKG 122
Query  126  DHVVSEEEHNVGRERIMNISKAVEAYLL 153
            +H V  E+    +E    + +AVE+YLL
Sbjct  123  NHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 103. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 99.5 bits 444,  Expect = 5e-23
 Identities = 64/158 40%, Positives = 101/158 63%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K ++++
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158

Sequence Alignment: 104. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 99.1 bits 442,  Expect = 6e-23
 Identities = 65/159 40%, Positives = 101/159 63%, Gaps = 0/159 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV  Y  E+ + IS  RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG   KY+K ++  +D+ N++  Y++IEGD+LG+KLE +  ++K  A   GG   K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 105. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 98.5 bits 439,  Expect = 9e-23
 Identities = 65/148 43%, Positives = 97/148 65%, Gaps = 0/148 0%
Query  6    YTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVEGGPI 65
            Y  E+T+ I   RLFKA++L+ DNL+PK+  Q + + E IEG+GG G+IK++ F EG P 
Sbjct  3    YESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPF 62
Query  66   KYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKG 125
            KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +YHTKG
Sbjct  63   KYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKG 122
Query  126  DHVVSEEEHNVGRERIMNISKAVEAYLL 153
            DH +  E     +E+   + +AVE+YLL
Sbjct  123  DHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 106. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 97.4 bits 434,  Expect = 2e-22
 Identities = 62/158 39%, Positives = 103/158 65%, Gaps = 0/158 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
            G P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K ++++
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            H KG H V+ E+    +E    + +AVE+YLLA+ + Y
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 107. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 97.0 bits 432,  Expect = 3e-22
 Identities = 68/156 43%, Positives = 100/156 64%, Gaps = 0/156 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  ++T+ ++P  L+KA+  D D + PK L    K+ E +EG+GG G+IK+++FV
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E G  K++ HKI  ID+ NL   YS++ G  L E  E IT+D K+    NGG + K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            YH+KGD   +E+E   G+ +  ++ KAVEAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 95.6 bits 425,  Expect = 7e-22
 Identities = 67/155 43%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
            GV T+  ++T+ ++P  L+KA+  D D + PK L    K+ E +EG+GG G+IK+++FVE
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
             G  K++ HKI  ID+ NL   YS++ G  L E  E IT+D K+    NGG + K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            H+KGD   +E+E   G+ +  ++ KAVEAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 109. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 94.8 bits 421,  Expect = 1e-21
 Identities = 68/155 43%, Positives = 99/155 63%, Gaps = 1/155 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E  + ++P  L+KALV D DN++PK L    K+ E +EG+GG G+IK++ F+
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSF-KSVENVEGNGGPGTIKKITFL 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E G  K++ HKI  ID+ NL   YS++ G  L +  E IT+D K+ A  NGG   K T +
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            Y TKGD   +++E   G+ +   + KA+EAYLLA+P
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 110. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 92.8 bits 411,  Expect = 4e-21
 Identities = 65/135 48%, Positives = 93/135 68%, Gaps = 1/135 0%
Query  11   TTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVEGGPIKYLKH 70
            T+ I P +LFKA+VLD DNL+PK+  Q VK+ E IEGDGGVG++K++++ EG    Y+KH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   KIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKGDHVVS 130
            KI  +D  N+   YS+ EGD LG+K+E I+Y+IK+ A+  G  + KTT+ YH KG   + 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGS-IIKTTSHYHCKGGAEIK 120
Query  131  EEEHNVGRERIMNISK 146
            EE+   G+ER   + K
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 93.0 bits 412,  Expect = 4e-21
 Identities = 66/155 42%, Positives = 99/155 63%, Gaps = 1/155 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            M V T+  ++T+ ++P  L+KALV D D +VPK +    K+ E +EG+GG G+IK+++FV
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFV 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E G  K++ HKI  ID+ NL   YS++ G  L +  E I+ D K+    NGG V K + +
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            YH+KGD   +E+E   G+ +   + K +EAYLLANP
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 90.5 bits 400,  Expect = 2e-20
 Identities = 64/157 40%, Positives = 98/157 62%, Gaps = 2/157 1%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+T+ P +L+ A+  D D++ PK++   VK+ E +EG+GG G+IK++  V
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E G  K++ HK+  ID+ N    YS++ G  L    E IT++ K+    NGG + K T +
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159
            YHTKGD    EEE   G+ +   + +A+E Y+LANP+ Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 113. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 90.3 bits 399,  Expect = 3e-20
 Identities = 58/149 38%, Positives = 98/149 65%, Gaps = 0/149 0%
Query  8    YESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVEGGPIKY 67
            +E T+++SP+ +FKA+V+DFD + PK   +  K+ +TIEGDGGVG+IK + + +G P   
Sbjct  6    FEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTS 65
Query  68   LKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKGDH 127
             KHK+  ID  N+   Y++ EGD+L   +ES T+ +KF  + +GG VYK +  +  KGD 
Sbjct  66   SKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDA 125
Query  128  VVSEEEHNVGRERIMNISKAVEAYLLANP 156
             +++E  ++ +E +    KA+E Y++++P
Sbjct  126  KLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 114. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 89.9 bits 397,  Expect = 3e-20
 Identities = 64/155 41%, Positives = 96/155 61%, Gaps = 1/155 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            M V T+  ++T+ ++P  L+ AL  D DN++PK +    ++ E +EG+GG G+IK+++FV
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVGSF-QSVEIVEGNGGPGTIKKISFV 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E G  K++ HKI  +D+ NL   YS++ G  L +  E IT D K     +GG + K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156
            YH KGD   +E+E   G+ +   + KAVEAYLLANP
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 89.7 bits 396,  Expect = 4e-20
 Identities = 65/155 41%, Positives = 94/155 60%, Gaps = 0/155 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV       T+++   +LFKAL LD D L+P++L   +K  E +EGDGGVG++K + + 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            +  P K +K+KI  ID + +   YS+I+GDIL   ++SI   + F    +GGC   +T  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            ++TKGD VV EE      ++   I KAVEAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 87.3 bits 384,  Expect = 2e-19
 Identities = 64/154 41%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV     E+ +T+S  ++++ ++LD D + PK+L Q +K+ E +EGDGGVG++K +++ 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E      +K+K+ VID   L   Y+ I GDIL + LES+  +      D GGC+ K TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTD-GGCIVKNTTI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            Y+TKGD V+ E++     E+     KAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 86.9 bits 382,  Expect = 3e-19
 Identities = 61/153 39%, Positives = 96/153 62%, Gaps = 2/153 1%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV+T+  EST+ + P +LFKA V+D D L PKL+   +++ E +EG+GG G++K++  V
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPA-IQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E G   Y+ HKI  ID+      Y++  G  + E LE +++  K+EA D GG   K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAAD-GGSKIKVSVT 118
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD  + +E H   +++   I KA+E Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 86.7 bits 381,  Expect = 3e-19
 Identities = 64/154 41%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV     E+ +T+S  ++++ ++LD D + PK+L Q +K+ E +EGDGGVG+++ +++ 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            E      +K+K+ VID   L   Y+ I GDIL E LES+         D GGC+ K TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTD-GGCIVKNTTI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            Y+TKGD V+ E++     E+     KAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 82.0 bits 358,  Expect = 8e-18
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MGV T+  E T+++S  ++F+ +V+D D ++PK      K+ E I+GDGG G++K + + 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            +GGPI  +  +I  ++ + L   YS+I+GDIL   +ESI   + +    +GG + KTT  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD VV EE      E+   + KA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 77.3 bits 335,  Expect = 2e-16
 Identities = 54/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  +++ E T+++S  ++F  +VLD D ++PK      K+ + ++GDGG G+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG PI  +  +   ++ + L    ++I+GDIL E +ESI   +      +GG + KTT  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD VV EE       +   + KA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 76.9 bits 333,  Expect = 3e-16
 Identities = 54/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  +++ E T+++S  ++F  +VLD D ++PK  +   K+ E ++GDGG G+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG PI  +  +   ++ + L    ++I+GDIL   +ESI   +      +GG + KTT  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD VV EE       +   + KA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 76.9 bits 333,  Expect = 3e-16
 Identities = 54/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  +++ E T+++S  ++F  +VLD D ++PK      K+ + ++GDGG G+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG PI  +  +   ++ + L    ++I+GDIL   +ESI   +      +GG + KTT  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD VV EE      E+   + KA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 76.9 bits 333,  Expect = 3e-16
 Identities = 54/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  +++ E T+++S  ++F  +VLD D ++PK      K+ + ++GDGG G+++ + + 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG PI  +  +   ++ + L    ++I+GDIL E +ESI   +      +GG + KTT  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD VV EE       +   + KA+EAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 76.3 bits 330,  Expect = 4e-16
 Identities = 54/154 35%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
            MG  +++ E T+++S  ++F  +VLD D ++PK      K+ E ++GDGG G+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
            EG PI  +  +   ++ + L    ++I+GDIL   +ESI   +      +GG + KTT  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155
            +HTKGD VV EE       +   + KA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 48.8 bits 194,  Expect = 5e-08
 Identities = 30/76 39%, Positives = 46/76 60%, Gaps = 0/76 0%
Query  84   YSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRERIMN 143
            Y  +EGD L + LE I Y+ K+ +  +   + KTT++YHTKGD  + EE    G+E+  +
Sbjct  24   YVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAH 83
Query  144  ISKAVEAYLLANPSVY 159
            + K +E YL  +PS Y
Sbjct  84   LFKLIEGYLKDHPSEY 99

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 44.9 bits 174,  Expect = 4e-07
 Identities = 27/49 55%, Positives = 36/49 73%, Gaps = 0/49 0%
Query  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG 50
            GV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 43.6 bits 169,  Expect = 3e-06
 Identities = 38/127 29%, Positives = 59/127 46%, Gaps = 4/127 3%
Query  3    VNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVEG 62
            V  +  ++  ++    L+  L  DF  +VPK+L + VK+ + IEGDGGVG+I   NF+  
Sbjct  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
Query  63   GPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYH 122
                Y + +I   D+ + E    +IEG  L + L       K+   +      KT     
Sbjct  62   VSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEED----KTLVNVK 117
Query  123  TKGDHVVSEEE 133
               DH    EE
Sbjct  118  ISYDHDSDIEE 128

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.