The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG
DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV
FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA67246 Pet c PR10 155 984 263.8 1.5e-72
P49372 Api g 1 154 620 168.6 7e-44
CAB06416 Dau c 1.0105 154 594 161.8 7.9e-42
CAB03716 Dau c 1.0104 154 594 161.8 7.9e-42
CAB03715 Dau c 1.0103 154 581 158.4 8.3e-41
BAA13604 Dau c 1.0102 154 577 157.3 1.7e-40
AAB01092 Dau c 1.0101 168 575 156.7 2.8e-40
AAL76932 Dau c 1.0201 154 572 156.0 4.3e-40
P92918 Api g 1.0201 159 572 156.0 4.5e-40
CAM31908 Act c 8.0101 159 497 136.3 3.6e-34
CAM31909 Act d 8.0101 157 489 134.3 1.5e-33
O50001 Pru ar 1 160 485 133.2 3.2e-33
CAA96535 Mal d 1.0401 160 466 128.2 1e-31
CAA96537 Mal d 1.0403 160 465 128.0 1.2e-31
CAA96536 Mal d 1.0402 160 457 125.9 5.2e-31
B6CQS9 Pru du 1.0101 160 454 125.1 9e-31
APD76154 Jug r 5.0101 160 449 123.8 2.2e-30
CAD10374 Cas s 1 160 448 123.5 2.7e-30
Q256S7 Fra a 1 160 447 123.3 3.2e-30
Q3T923 Fra a 1 160 447 123.3 3.2e-30
AUH28179 Que m 1.0101 160 445 122.7 4.6e-30
AAB92255 Tar o RAP 157 444 122.5 5.3e-30
QGS84240 Que i 1.0101 159 444 122.5 5.4e-30
ABZ81046 Que a 1.0301 160 443 122.2 6.6e-30
ABZ81047 Que a 1.0401 160 441 121.7 9.5e-30
AFN42528 Can s 5.0101 161 441 121.7 9.6e-30
Q2I6V8 Pru p 1.0101 160 438 120.9 1.6e-29
Q256S6 Fra a 1 160 438 120.9 1.6e-29
O24248 Pru av 1 160 437 120.6 2e-29
CAA96534 Mal d 1.0301 159 434 119.9 3.3e-29
AAO25113 Mal d 1.0304 159 433 119.6 4e-29
Q256S4 Fra a 1 159 433 119.6 4e-29
Q256S2 Fra a 1 160 433 119.6 4e-29
AAK13027 Mal d 1.0302 159 431 119.1 5.8e-29
ACJ23864 Fag s 1.0101 160 430 118.8 7e-29
ABZ81045 Que a 1.0201 159 429 118.5 8.3e-29
QOL10866 Que ac 1.0101 159 428 118.3 9.9e-29
AAK13028 Mal d 1.0303 159 421 116.5 3.5e-28
CAA96549 Cor a 1.0301 160 419 115.9 5.1e-28
Q39427 Bet v 1.0205 160 413 114.4 1.5e-27
CAA54421 Bet v 1.0201 160 412 114.1 1.8e-27
CAA50325 Cor a 1.0103 160 411 113.8 2.2e-27
CAA54482 Bet v 1.0102 160 411 113.8 2.2e-27
CAA54481 Bet v 1.0202 160 411 113.8 2.2e-27
P43186 Bet v 1.0204 160 411 113.8 2.2e-27
CAB02157 Bet v 1.0110 160 411 113.8 2.2e-27
P43184 Bet v 1.0203 160 410 113.6 2.6e-27
CAA07323.1 Bet v 1.0117 160 410 113.6 2.6e-27
CAA58646 Mal d 1.0101 159 409 113.3 3.1e-27
AAB01362 Mal d 1.0201 159 409 113.3 3.1e-27
AAD26545 Mal d 1.0202 159 409 113.3 3.1e-27
CAB02155 Bet v 1.0108 160 409 113.3 3.1e-27
AAD26554 Mal d 1.0106 159 408 113.0 3.7e-27
AAK13029 Mal d 1.0109 159 407 112.8 4.5e-27
AAD26546 Mal d 1.0103 159 407 112.8 4.5e-27
AAD29671 Mal d 1.0108 159 407 112.8 4.5e-27
CAA50327 Cor a 1.0101 160 407 112.8 4.5e-27
CAB02158 Bet v 1.0111 160 407 112.8 4.5e-27
CAA04828.1 Bet v 1.0206 159 406 112.5 5.4e-27
AAD26548 Mal d 1.0204 159 405 112.3 6.4e-27
AAK13030 Mal d 1.0207 159 405 112.3 6.4e-27
AAD26553 Mal d 1.0105 159 405 112.3 6.4e-27
CAB02216 Car b 1.0301 161 405 112.3 6.6e-27
O65200 Pyr c 1 159 404 112.0 7.7e-27
CAA88833 Mal d 1.0102 159 404 112.0 7.7e-27
AAD26552 Mal d 1.0104 159 404 112.0 7.7e-27
AAD13683 Mal d 1.0206 159 404 112.0 7.7e-27
CAA54489 Bet v 1.0107 160 404 112.0 7.8e-27
AAB24432 Aln g 1 160 404 112.0 7.8e-27
CAB02217 Car b 1.0302 161 404 112.0 7.9e-27
AAD26547 Mal d 1.0203 159 403 111.7 9.3e-27
AAD26555 Mal d 1.0107 159 402 111.5 1.1e-26
CAB02160 Bet v 1.0113 160 402 111.5 1.1e-26
CAA96548 Cor a 1.0201 160 402 111.5 1.1e-26
CAD32318 Mal d 1.0208 158 401 111.2 1.3e-26
AAD26558 Mal d 1.0205 159 401 111.2 1.3e-26
NP_001275580 Sola l 4.0201 160 401 111.2 1.3e-26
CAA50328 Cor a 1.0102 160 401 111.2 1.3e-26
CAA33887 Bet v 1.0101 160 401 111.2 1.3e-26
CAB02159 Bet v 1.0112 160 401 111.2 1.3e-26
CAA54484 Bet v 1.0104 160 401 111.2 1.3e-26
Q08407 Cor a 1 159 400 111.0 1.6e-26
CAA54485 Bet v 1.0105 160 400 110.9 1.6e-26
CAB02161 Bet v 1.0114 160 400 110.9 1.6e-26
CAB02156 Bet v 1.0109 160 400 110.9 1.6e-26
P38948 Aln g 1 159 397 110.2 2.8e-26
CAA54487 Bet v 1.0106 160 397 110.2 2.8e-26
CAA07329.1 Bet v 1.0118 160 397 110.2 2.8e-26
CAB02209 Car b 1.0106 160 396 109.9 3.3e-26
CAB02213 Car b 1.0107 160 396 109.9 3.3e-26
CAB02208 Car b 1.0105 160 396 109.9 3.3e-26
AHC08073 Sola l 4.0101 160 396 109.9 3.3e-26
CAA04827.1 Bet v 1.0116 159 395 109.6 4e-26
CAA54483 Bet v 1.0103 160 395 109.6 4e-26
CAB02215 Car b 1.0108 160 395 109.6 4e-26
ABZ81041 Car b 1.0110 160 393 109.1 5.7e-26
CAB02207 Car b 1.0104 160 392 108.9 6.9e-26
ABZ81043 Car b 1.0112 160 392 108.9 6.9e-26
ABZ81042 Car b 1.0111 160 392 108.9 6.9e-26
CAB02206 Car b 1.0103 160 392 108.9 6.9e-26
AAG40329 Cor a 1.0402 161 391 108.6 8.3e-26
ABZ81040 Car b 1.0109 160 390 108.3 9.9e-26
ABZ81044 Car b 1.0113 160 388 107.8 1.4e-25
ADK39021 Ost c 1.0101 160 388 107.8 1.4e-25
AAG40330 Cor a 1.0403 161 388 107.8 1.4e-25
CAA96547 Bet v 1.0115 160 387 107.5 1.7e-25
CAA50326 Cor a 1.0104 160 387 107.5 1.7e-25
ACF75030.1 Bet v 1.0207 150 385 107.1 2.2e-25
ABC41615.1 Bet v 1.0119 150 382 106.3 3.8e-25
P38950 Car b 1 159 377 104.9 1e-24
AAG40331 Cor a 1.0404 161 375 104.4 1.5e-24
AAD48405 Cor a 1.0401 161 375 104.4 1.5e-24
CAA47357 Car b 1.0102 159 374 104.1 1.8e-24
CAA54696.1 Bet v 1.0301 160 374 104.1 1.8e-24
Q0Z8U9 Rub i 1.0101 137 362 101.1 1.3e-23
P38949 Car b 1 159 361 100.7 1.9e-23
CAA75803 Lyc e 4.0101 178 357 99.6 4.6e-23
EF436550 Ara h 8.0201 153 345 96.6 3.3e-22
CAA43637 Pha v 1 156 324 91.1 1.5e-20
P25985 Pha v 1 155 317 89.2 5.3e-20
AAQ91847 Ara h 8.0101 157 314 88.4 9.4e-20
CAA42646 Gly m 4 158 303 85.6 7e-19
Q2VU97 Vig r 1.0101 155 300 84.8 1.2e-18
CAA43636 Pha v 1 155 294 83.2 3.5e-18
P85126 Que a 1.0101 50 152 46.8 1e-07
Q9ZWP8 Vig r 6.0101 155 154 46.6 3.7e-07
Q5ULZ4 Fra a 1.0101 100 130 40.6 1.5e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 263.8 bits 984,  Expect = 1e-72
 Identities = 155/155 100%, Positives = 155/155 100%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 2. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 168.6 bits 620,  Expect = 7e-44
 Identities = 93/154 60%, Positives = 123/154 79%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGVQ   + +TSSV A K+F+ + +D+DT+LP+  PGA K  EI +GDGG GT+K++TL 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            D  P  TM  +ID ++KEA+TF YS+IDGDILLG+I+SI NH+ +VPTADGG    +TA+
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDAVVPEENIK+AN+QN  +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 3. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 161.8 bits 594,  Expect = 8e-42
 Identities = 88/154 57%, Positives = 118/154 76%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG Q   + ITSSV A K+F  + LD+DT++P+  PGA K  E+ +GDGG GTV+++TL 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP  +M  + DA++KEA+T+  ++IDGDILLG+I+SI  HL  VPTADGG    +TA+
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDAVVPEENIKFA+ QN  +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 4. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 161.8 bits 594,  Expect = 8e-42
 Identities = 87/154 56%, Positives = 119/154 77%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG Q   + ITSSV A K+F  + LD+DT++P+  PGA K  ++ +GDGG GTV+++TL 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP  +M  + DA++KEA+T+  ++IDGDILLG+I+SI  HL  VPTADGG    +TA+
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDAVVPEENIKFA++QN  +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 5. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 158.4 bits 581,  Expect = 8e-41
 Identities = 86/154 55%, Positives = 117/154 75%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG Q   + ITSSV A K+F  + LD+DT++P+   GA K  E+ +GDGG GTV+++TL 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP  TM  + DA++KEA+++  ++IDGDILLG+I+SI  H+  VPTADGG    +TA+
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDAVVPEENIKFA+ QN  +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 6. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 157.3 bits 577,  Expect = 2e-40
 Identities = 85/154 55%, Positives = 117/154 75%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG Q   + ITSSV A K+F  + LD+DT++P+  PGA K  ++ +GDGG GTV+++TL 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP  +M  + DA++KEA+T+  ++IDGDILL +I+SI  H+  VPTADGG    +TA+
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDAVVPEENIKFA+ QN  +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 7. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 156.7 bits 575,  Expect = 3e-40
 Identities = 85/154 55%, Positives = 117/154 75%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG Q   + ITSSV A K+F  + LD+DT++P+  PGA K  ++ +GDGG GTV+++TL 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP  +M  + DA++KEA+T+  ++IDGDILL +I+SI  H+  VPTADGG    +TA+
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDAVVPEENIKFA+ QN  +FKA+EAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 8. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 156.0 bits 572,  Expect = 4e-40
 Identities = 87/154 56%, Positives = 120/154 77%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGVQK+EV   S+V A K+++ + LD+DT++P+VLP  IK  EILEGDGGVGTV+LV LG
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +A+ Y TMKQK+D IDK  + ++Y+ I GDIL+  ++S+ N++  VPT DGGC   +T +
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +NTKGDAV+PE+ +K A +++ L FKAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 9. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 156.0 bits 572,  Expect = 4e-40
 Identities = 88/154 57%, Positives = 118/154 76%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGVQK+ V   S+V A K+++ + LD+DT++P+VLP  IK  EILEGDGGVGTVKLV LG
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +A+ Y TMKQK+D IDK  + ++Y+ I GDIL+  ++S+ N +  VPT DGGC   +T +
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +NTKGDAV+PE+ IK A +++ L FKAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 10. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 136.3 bits 497,  Expect = 4e-34
 Identities = 79/155 50%, Positives = 110/155 70%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   ++ I S VP  KL+KA+ LD DTL+P+VLP AIK  +ILEGDG  GT+K VT+G
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S +K +KQ++DAIDK+ +T+SY+II+GD+L    +SI+ H+  V   DGG    + ++
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGD  V EE IK+  ++   IFKA+EAYLLAN
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 11. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 134.3 bits 489,  Expect = 2e-33
 Identities = 78/154 50%, Positives = 108/154 70%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG    ++ I SS+ A K+FKA+ LD DT++P+ LP AI G + LEGDGGVGT+KL T+G
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S +K++K++ID +DKE FT+SYSII+G  L    +SI+ H+  V T DGGC   + ++
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +  K DA V EE IK   ++ + IFK VEAYLLAN
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 12. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 133.2 bits 485,  Expect = 3e-33
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  KLFKA+ LD D L+P+V P A+KG EILEGDGGVGT+K VT+G
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+++D IDK+ +++SY++I+GD L   I++I   + +V + DGG    +T+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  + EE +K   ++   +FK VEAYLLAN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155

Sequence Alignment: 13. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 128.2 bits 466,  Expect = 1e-31
 Identities = 70/155 45%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA +LFKA+ LD D L+P++ P AIK  EI+EGDGGVGT+K VT+G
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +KQ+++ IDK+ FT+SYS+I+GD L   ++ I     ++ + DGG    +T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++ KGD  + EE++K   ++ + +FK +EAYLLA+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 14. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 128.0 bits 465,  Expect = 1e-31
 Identities = 70/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA +LFKA+ LD D L+P++ P AIK  EI+EGDGGVGT+K VT+G
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +KQ+++ IDK+ FT+SYS+I+GD L   ++ I     ++ + DGG    +T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +  KGD  + EE++K   ++ + +FK +EAYLLA+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 15. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 125.9 bits 457,  Expect = 5e-31
 Identities = 68/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA +LFKA+ LD D L+P++ P AIK  +I+EGDGGVGT+K VT+G
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +KQ+++ IDK+ FT+SYS+I+GD L   ++ I     ++ + DGG    + + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++ KGD  + EE++K   ++ + +FK +EAYLLA+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 16. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 125.1 bits 454,  Expect = 9e-31
 Identities = 64/155 41%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG+       TS +P  +LFKAL L+ DTL+P++ P ++K  EI+EGDGGVGT+K +++G
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID +DK+ F ++YS+++GD L   ++ I+  + +V +ADGG    ST+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  + EE++K   ++   +FK +E YL+AN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVAN 155

Sequence Alignment: 17. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 123.8 bits 449,  Expect = 2e-30
 Identities = 68/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFKA+ LD D L+P+V+P A+K  EI+EG+GG GT+K + +G
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S YK +K++ DAID+  FT++YS+I+GD L   I+ I+     V + +GG    S + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +++KGD  + EE++K   ++ + +FKAVE YLLA+
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 18. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 123.5 bits 448,  Expect = 3e-30
 Identities = 67/155 43%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E  ITS++P  +LFKA+ LD D L+P++ P AIK  EI+EG+GG GT+K +T+G
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S +K +K++ID ID+  FT+ YS+I+GD++   ++ I+  +  V + DGG    +T+ 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  + EE +    ++   +FKAVEAYLLA+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 19. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 123.3 bits 447,  Expect = 3e-30
 Identities = 70/152 46%, Positives = 100/152 65%, Gaps = 0/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA KLFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KI +IDKE  T+SYS+I+GD L   I+ I+    +V    GG    +T+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 20. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 123.3 bits 447,  Expect = 3e-30
 Identities = 69/152 45%, Positives = 100/152 65%, Gaps = 0/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA KLFKA+ LD D L+P++ P A+K  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KI +IDKE  T+SYS+I+GD L   I+ I+    +V    GG    +T+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 21. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 122.7 bits 445,  Expect = 5e-30
 Identities = 69/155 44%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +P A+LFKA+ LD D L+P+V+P A+K  EI+EG+GG GT+K +T+G
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S  K  K++ID ID E FTFS+S+I+GD L+  +++++     V + DGG    ST  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGD  + +E I+   ++ + +FKAVEAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 22. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 122.5 bits 444,  Expect = 5e-30
 Identities = 63/150 42%, Positives = 99/150 66%, Gaps = 0/150 0%
Query  6    SEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGDASPY 65
            +E  ITSS+  + +FKA+ +D DT+ P+  P   K  + +EGDGGVGT+K +T  D  P+
Sbjct  4    AEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPF 63
Query  66   KTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKG 125
             + K+K+DAID   F+ SY+I +GD+L+G I+S  +HL F+P+ADGG     + VF  KG
Sbjct  64   TSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKG 123
Query  126  DAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            DA + +EN+ +  +     FKA+E Y++++
Sbjct  124  DAKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 23. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 122.5 bits 444,  Expect = 5e-30
 Identities = 73/154 47%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFKA+ LD D L+P+VLP AIK  E +EG+GG GT+K +T+G
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +AS +K  K++IDA+D E  T+S+S+I+GD L   + S++  + FV + DGG    ST  
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGD  + EE I+   ++   + KAVEAYLLA+
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154

Sequence Alignment: 24. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 122.2 bits 443,  Expect = 7e-30
 Identities = 68/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +P A+LFKA+ LD D L+P+V+P A+K  EI+EG+GG GT+K +T+G
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S  K  K++ID ID E FT+S+S+I+GD L+  +++++     V + DGG    ST+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGD  + +E I+   ++ + +FKAVEAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155

Sequence Alignment: 25. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 121.7 bits 441,  Expect = 9e-30
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +  A+LFKAL LD D L+ +VLP AIK  EI+EG+GG GT+K +T+G
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S  K  K++ID ID E FT+S+S+I+GD L+  +++++     V + DGG  A ST+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGD  + +E I+   ++ + +FKAVEAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 26. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 121.7 bits 441,  Expect = 1e-29
 Identities = 71/152 46%, Positives = 103/152 67%, Gaps = 1/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TSS+  A+LFKA+ LD D L+P++ P A++  EILEG+GGVGT+K +T+G
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLG-YIDSINNHLSFVPTADGGCTATSTA 119
               P+K +K+KI+AIDKE++T+SYSII+GD L G  ++ I +   +V + DGG    + +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  VFNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
             + + GDA V EE +K    Q   ++K VEAYL
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYL 153

Sequence Alignment: 27. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 120.9 bits 438,  Expect = 2e-29
 Identities = 67/152 44%, Positives = 101/152 66%, Gaps = 0/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID+IDKE  ++SY++I+GD L   ++ I+    +V +  GG    ST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 28. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 120.9 bits 438,  Expect = 2e-29
 Identities = 69/152 45%, Positives = 99/152 65%, Gaps = 0/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG    E   TS +PA KLFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KI +IDKE  T+SYS+I+GD L   I+ I+    +V    GG    +T+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 29. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 120.6 bits 437,  Expect = 2e-29
 Identities = 66/152 43%, Positives = 102/152 67%, Gaps = 0/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID+IDKE +++SY++I+GD L   ++ I+    +V +  GG    ST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E YL
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 30. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 119.9 bits 434,  Expect = 3e-29
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LF A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID +DKE F + YS+I+GD +   I+ I+    +V +  G     ST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TK D  + EE++K   ++ + +FK +E YLLA+
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 31. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 119.6 bits 433,  Expect = 4e-29
 Identities = 65/152 42%, Positives = 99/152 65%, Gaps = 1/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LF A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID +DKE F + YS+I+GD +   I+ I+    +V +  G     ST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLL 153
            ++TKGD  + EE++K   ++ + +FK +E YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 32. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 119.6 bits 433,  Expect = 4e-29
 Identities = 69/151 45%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA KLFKA+ LD D L+P++ P A+K  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KI +IDKE  T+SYS+I+GD L   I+ I+    +V +A  G    +T+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLV-SAPHGTIIKTTSK 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151

Sequence Alignment: 33. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 119.6 bits 433,  Expect = 4e-29
 Identities = 68/152 44%, Positives = 98/152 64%, Gaps = 0/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PA KLFKA+ LD D L+P++ P A+K  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KI +IDK   T+SYS+I+GD L   I+ I+    +V    GG    +T+ 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++   +FK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYL 152

Sequence Alignment: 34. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 119.1 bits 431,  Expect = 6e-29
 Identities = 65/152 42%, Positives = 99/152 65%, Gaps = 1/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LF A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID +DK+ F + YS+I+GD +   I+ I+    +V  A  G    ST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLL 153
            ++TKGD  + EE++K   ++ + +FK +E YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 35. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 118.8 bits 430,  Expect = 7e-29
 Identities = 68/155 43%, Positives = 102/155 65%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   T+ +  A+LFKA+ LD D L+P+V P AIK  EI+EG GG GT+K +T+G
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S +  +K++ID ID   FT++ ++I+GD +   ++ I   + +V + DGG    ST+ 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  + E+ IK   ++ + IFKAVEAYLLAN
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155

Sequence Alignment: 36. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 118.5 bits 429,  Expect = 8e-29
 Identities = 72/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +  A+LFKAL LD D L+ +VLP AIK  EI+EG+GG GT+K +T+G
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +AS +K  K++IDA+D E  T+S+S+I+GD L   ++S++  +  V + DGG    ST  
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGD  + EE I+ A ++   ++KAVEAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154

Sequence Alignment: 37. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 118.3 bits 428,  Expect = 1e-28
 Identities = 72/154 46%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFKA+ LD D L+ +VLP A+K  EI+EG+GG GT+K  T+G
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +AS  K  K++ID +D E  ++S+S+I+G+ L   I SI+  + FV + DGG    ST  
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKG   + EE I+ A ++   +FKAVEAYLLA+
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154

Sequence Alignment: 38. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 116.5 bits 421,  Expect = 4e-28
 Identities = 63/152 41%, Positives = 98/152 64%, Gaps = 1/152 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+L+ A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID +DK+ F + YS+I+GD +   I+ I+    +V +  G     S + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGS-VIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLL 153
            ++TKGD  + EE++K   ++ + +FK +E YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 39. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 115.9 bits 419,  Expect = 5e-28
 Identities = 65/155 41%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFK + LD D L+P+V P AIK  EI+EG+GG GT+K + + 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+  +KQK++ ID+  F++ YS+I+GD L   ++ IN  +  V +  GG    S + 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++T GD  + +E IK   ++ + +FKAVE YLLA+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 40. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 114.4 bits 413,  Expect = 2e-27
 Identities = 64/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F +SYS+I+G  L   ++ I N + +V T DGG     +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 41. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 114.1 bits 412,  Expect = 2e-27
 Identities = 64/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ L+ DTL+P+V P AI   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F +SYS+I+G  L   ++ I N +  V T DGG     +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 42. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 113.8 bits 411,  Expect = 2e-27
 Identities = 64/155 41%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S YK +K+++D +D   FT+SY++I+GD+L   ++ + + L  V    GG     ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  +  E IK A +    +++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 43. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 113.8 bits 411,  Expect = 2e-27
 Identities = 61/155 39%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E+  TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K + + 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 44. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 113.8 bits 411,  Expect = 2e-27
 Identities = 64/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ L+ DTL+P+V P AI   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F +SYS+I+G  L   ++ I N +  V T DGG     +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 45. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 113.8 bits 411,  Expect = 2e-27
 Identities = 64/155 41%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F +SYS+I+G  L   ++ I N +  V T DGG     +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 46. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 113.8 bits 411,  Expect = 2e-27
 Identities = 61/155 39%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 47. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 113.6 bits 410,  Expect = 3e-27
 Identities = 64/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ L+ DTL+P+V P AI   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F +SYS+I+G  L   ++ I N +  V T DGG     +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 48. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 113.6 bits 410,  Expect = 3e-27
 Identities = 61/155 39%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 49. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 113.3 bits 409,  Expect = 3e-27
 Identities = 62/151 41%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 50. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 113.3 bits 409,  Expect = 3e-27
 Identities = 61/151 40%, Positives = 100/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 51. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 113.3 bits 409,  Expect = 3e-27
 Identities = 61/151 40%, Positives = 100/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 52. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 113.3 bits 409,  Expect = 3e-27
 Identities = 61/155 39%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 53. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 113.0 bits 408,  Expect = 4e-27
 Identities = 62/151 41%, Positives = 103/151 68%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I++I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 54. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 112.8 bits 407,  Expect = 4e-27
 Identities = 62/151 41%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 55. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 112.8 bits 407,  Expect = 4e-27
 Identities = 62/151 41%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 56. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 112.8 bits 407,  Expect = 4e-27
 Identities = 62/151 41%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 57. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 112.8 bits 407,  Expect = 5e-27
 Identities = 63/155 40%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   EV   S +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S YK +K+++D +D   FT+SY++I+GD+L   ++ + + L  V    GG     ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  +  E +K A +    +++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 58. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 112.8 bits 407,  Expect = 5e-27
 Identities = 61/155 39%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
               P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 59. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 112.5 bits 406,  Expect = 5e-27
 Identities = 63/154 40%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +T+ +
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
             SP+K +K+++D +D   F +SYS+I+G  L   ++ I N + +V T DGG     +  +
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 60. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 112.3 bits 405,  Expect = 6e-27
 Identities = 60/151 39%, Positives = 100/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    ++ +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 61. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 112.3 bits 405,  Expect = 6e-27
 Identities = 61/151 40%, Positives = 99/151 65%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 62. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 112.3 bits 405,  Expect = 6e-27
 Identities = 62/151 41%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 63. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 112.3 bits 405,  Expect = 7e-27
 Identities = 63/155 40%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD + L+P+V P A+   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP K +K++++ +D   F +SY++I+G  +   ++ I N +  V   DGG     T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  VP E+IK   ++   ++K VEAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 64. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 60/151 39%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MG+   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+++D+ID+ +++++Y++I+GD L   I+ I+    +V +  G  T  S + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 65. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 61/151 40%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGA-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++ KG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYL 151

Sequence Alignment: 66. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 62/151 41%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 67. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 60/151 39%, Positives = 99/151 65%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFK + LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 68. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 60/155 38%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA++FKA+ LD D L+P+V P AI   E +EG+GG GT+K + + 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 69. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 62/155 40%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFKA+ LD D LLP+V P A+   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D+  F +S+S+I+G  +   ++ + N +  V   DGG     +  
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGD  +  E IK   ++   ++KAVE+YLLA+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 70. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 112.0 bits 404,  Expect = 8e-27
 Identities = 63/155 40%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD + L+P+V P A+   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP K +K++++ +D   F +SY++I+G  +   ++ I N +  V   DGG     T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  VP E+IK   ++   ++K VEAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 71. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 111.7 bits 403,  Expect = 9e-27
 Identities = 60/151 39%, Positives = 100/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++K   ++ + +FK +E++L
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHL 151

Sequence Alignment: 72. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 111.5 bits 402,  Expect = 1e-26
 Identities = 62/151 41%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKG+  + EE++K    + + +FK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYL 151

Sequence Alignment: 73. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 111.5 bits 402,  Expect = 1e-26
 Identities = 61/155 39%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGG     +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 74. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 111.5 bits 402,  Expect = 1e-26
 Identities = 62/155 40%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD + L+P+V P A+   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K++++ +D   F +SY++I+G  +   ++ I N +  V   DGG     +  
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E+IK   ++   +F+AVEAYLLA+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 75. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 60/150 40%, Positives = 99/150 66%, Gaps = 1/150 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G+
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
             S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISHY 119
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            +TKGD  + EE++K   ++ + +FK +E+YL
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYL 150

Sequence Alignment: 76. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 60/151 39%, Positives = 99/151 65%, Gaps = 1/151 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152
            ++TKGD  + EE++    ++ + +FK +E+YL
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151

Sequence Alignment: 77. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 63/155 40%, Positives = 94/155 60%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV       T+++   +LFK L LD D+L+P++L   +K  EI+EGDGG G++K + + 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P K +K+KI  ID + +   YS+I+GD+L   ++SI   + F    DGGC   +T  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD VV EE       +   +FKA+EAYLLAN
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155

Sequence Alignment: 78. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 62/155 40%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   EV   S +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S YK +K+++D +D   F +SY++I+GD+L   ++ + + L  V    GG     ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  +  E +K A +    +++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 79. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 61/155 39%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGG     +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 80. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 61/155 39%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGG     +  
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 81. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 111.2 bits 401,  Expect = 1e-26
 Identities = 62/155 40%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E+  TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F +SYS+I+G  +   ++ I+N +  V T +GG        
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E IK + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 82. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 111.0 bits 400,  Expect = 2e-26
 Identities = 62/154 40%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   EV   S +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G+
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
             S YK +K+++D +D   FT+SY++I+GD+L   ++ + + L  V    GG     ++ F
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + KGD  +  E +K A +    +++AVE YLLA+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 83. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 110.9 bits 400,  Expect = 2e-26
 Identities = 60/155 38%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ L+ D L+P+V P AI   E +EG+GG GT+K + + 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 84. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 110.9 bits 400,  Expect = 2e-26
 Identities = 61/155 39%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGG     +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 85. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 110.9 bits 400,  Expect = 2e-26
 Identities = 61/155 39%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGG     +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E +K + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 86. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 110.2 bits 397,  Expect = 3e-26
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E    S +PAA+LFKA+ LD D LLP+V P A+   E +EG+GG GT+K +T+ +
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
             SP+K +K+++D +D+  F +S+S+I+G  +   ++ + N +  V   DGG     +  F
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +TKGD  +  E IK   ++   ++KAVE+YLLA+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 87. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 110.2 bits 397,  Expect = 3e-26
 Identities = 62/155 40%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F +SYS+I+G  +   ++ I+N +  V T +GG        
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E IK + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 88. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 110.2 bits 397,  Expect = 3e-26
 Identities = 60/155 38%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N + +V T DGG     +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 89. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 109.9 bits 396,  Expect = 3e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 90. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 109.9 bits 396,  Expect = 3e-26
 Identities = 61/155 39%, Positives = 95/155 61%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F FSY++I+GD+L   ++ ++  L  V    GG     +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 91. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 109.9 bits 396,  Expect = 3e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 92. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 109.9 bits 396,  Expect = 3e-26
 Identities = 65/155 41%, Positives = 94/155 60%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV       T+++   +LFKAL LD D L+P++L   +K  E +EGDGGVG++K + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P K +K+KI  ID + +   YS+I+GDIL   ++SI   + F    +GGC   +T  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD VV EE      ++   I KAVEAYLLAN
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155

Sequence Alignment: 93. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 109.6 bits 395,  Expect = 4e-26
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ +
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
              P+K +K ++D +D   F +SYS+I+G  +   ++ I+N +  V T DGG     +  +
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +TKGD  V  E +K + +    +++AVE+YLLA+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 94. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 109.6 bits 395,  Expect = 4e-26
 Identities = 62/155 40%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +D   F +SYS+I+G  +   ++ I+N +  V T +GG        
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E IK + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 95. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 109.6 bits 395,  Expect = 4e-26
 Identities = 61/155 39%, Positives = 96/155 61%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F FSY++I+GD+L   ++ ++  L+ V    GG     +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 96. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 109.1 bits 393,  Expect = 6e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 97. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 108.9 bits 392,  Expect = 7e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 98. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 108.9 bits 392,  Expect = 7e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 99. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 108.9 bits 392,  Expect = 7e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 100. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 108.9 bits 392,  Expect = 7e-26
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 101. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 108.6 bits 391,  Expect = 8e-26
 Identities = 65/155 41%, Positives = 96/155 61%, Gaps = 1/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFK++ LD D L+P+V P    G E LEG+GG GT+K +T+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATS-TA 119
            + S +K MK+K++ ID   F + YSII+G  L   ++ I+  +       GG +    T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  VFNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
             ++TKG+A + EE IK   ++   +FKAVEAYLLA+
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 102. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 108.3 bits 390,  Expect = 1e-25
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 103. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 107.8 bits 388,  Expect = 1e-25
 Identities = 59/155 38%, Positives = 96/155 61%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K+++D +D   F +SY++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 104. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 107.8 bits 388,  Expect = 1e-25
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 105. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 107.8 bits 388,  Expect = 1e-25
 Identities = 65/155 41%, Positives = 96/155 61%, Gaps = 1/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFK++ LD D L+P+V P    G E LEG+GG GT+K +T+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATS-TA 119
            + S +K MK+K++ ID   F + YSII+G  L   ++ I+  +       GG +    T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  VFNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
             ++TKG+A + EE IK   ++   +FKAVEAYLLA+
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 106. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 107.5 bits 387,  Expect = 2e-25
 Identities = 61/155 39%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P+K +K ++D +  + F +SYS+I+G  +   ++ I+N +  V T DG      +  
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  V  E IK + +    +++AVE+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 107. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 107.5 bits 387,  Expect = 2e-25
 Identities = 61/155 39%, Positives = 96/155 61%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   EV   S + AA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+G
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S YK +K+++D +D   F +SY++I+GD+L   ++ + + L  V    GG T   ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+ KGD  +  E +K A +    +++AVE YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 108. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 107.1 bits 385,  Expect = 2e-25
 Identities = 58/143 40%, Positives = 94/143 65%, Gaps = 0/143 0%
Query  11   TSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGDASPYKTMKQ 70
            TS +PAA+LFKA+ L+ D L+P+V P AI   E +EG+GG GT+K +T+ + SP+K +K+
Sbjct  8    TSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYVKE 67
Query  71   KIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKGDAVVP 130
            ++D +D   F +SYS+I+G  L   ++ I N +  V T DGG     +  ++TKGD  + 
Sbjct  68   RVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMK 127
Query  131  EENIKFANDQNNLIFKAVEAYLL 153
             E++K   ++   +++AVE+YLL
Sbjct  128  AEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 109. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 106.3 bits 382,  Expect = 4e-25
 Identities = 56/147 38%, Positives = 93/147 63%, Gaps = 0/147 0%
Query  7    EVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGDASPYK 66
            E   TS +PAA+LFKA+ LD D L+P+V P AI   + +EG+GG GT+K + + +  P+K
Sbjct  4    ETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFPFK 63
Query  67   TMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKGD 126
             +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  ++TKG+
Sbjct  64   YVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTKGN 123
Query  127  AVVPEENIKFANDQNNLIFKAVEAYLL 153
              V  E +K + +    +++AVE+YLL
Sbjct  124  HEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 110. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 104.9 bits 377,  Expect = 1e-24
 Identities = 58/154 37%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E   TS +PAA+LFKA+ LD + L+P+V P A+   E +EG+GG GT+K +T+ +
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
             SP K +K++++ ID   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ F
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + KG   V  E +K A +    +++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 111. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 104.4 bits 375,  Expect = 2e-24
 Identities = 63/155 40%, Positives = 94/155 60%, Gaps = 1/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFK++ LD D L+P+V P      E LEG+GG GT+K +T+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATS-TA 119
            + + +K MK+K++ ID   F + YSII+G  L   ++ I   +       GG +    T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  VFNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
             ++TKG+A + EE IK   ++   +FKAVEAYLLA+
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 112. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 104.4 bits 375,  Expect = 2e-24
 Identities = 63/155 40%, Positives = 95/155 61%, Gaps = 1/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +P A+LFK++ LD D L+P+V P      E LEG+GG GT+K +T+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATS-TA 119
            + + +K MK+K++ ID   F + YSII+G  L   ++ I+  +       GG +    T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  VFNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
             ++TKG+A + EE IK   ++   +FKAVEAYLLA+
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 113. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 104.1 bits 374,  Expect = 2e-24
 Identities = 57/154 37%, Positives = 95/154 61%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ +
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
             SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ F
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + KG   V  E +K A +    +++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 114. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 104.1 bits 374,  Expect = 2e-24
 Identities = 61/155 39%, Positives = 93/155 60%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS +  A+LFK++ LD D L+P+V P  +   E +EG+GG GT+K +T+ 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            + S +K MK+++D ID   F + YSII+G  L   ++ I+  +  V    GG     T+ 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGD  + EE IK   ++   +FKAVE YL+A+
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAH 155

Sequence Alignment: 115. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 101.1 bits 362,  Expect = 1e-23
 Identities = 58/135 42%, Positives = 87/135 64%, Gaps = 1/135 0%
Query  11   TSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGDASPYKTMKQ 70
            TS +P  KLFKA+ LD D L+P++ P A+K  EI+EGDGGVGTVK + LG+ + +  +K+
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   KIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKGDAVVP 130
            KID +DK  F +SYSI +GD L   I+ I+  + +V +  G    T T+ ++ KG A + 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKT-TSHYHCKGGAEIK 120
Query  131  EENIKFANDQNNLIFK 146
            EE +K   ++   +FK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 116. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 100.7 bits 361,  Expect = 2e-23
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E    S +PAA+LFK+  LD D L+P+V P  I   E + G+GG GT+K +T+ +
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
              P+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ F
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + KG   V  E +K A +    +++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 117. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 99.6 bits 357,  Expect = 5e-23
 Identities = 56/146 38%, Positives = 86/146 58%, Gaps = 0/146 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV       T+++   +LFKAL LD D L+P++L   +K  E +EGDGGVG++K + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +  P K +K+KI  ID + +   YS+I+GDIL   ++SI   + F    +GGC   +T  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFK 146
            ++TKGD VV EE       +N+  F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 118. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 96.6 bits 345,  Expect = 3e-22
 Identities = 63/153 41%, Positives = 94/153 61%, Gaps = 2/153 1%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV+  E   TS VP AKLFKA  +D D L P+++P AI+  EI+EG+GG GTVK VT  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +      + +KIDAID+  +T+ Y+I  G  +   ++ ++    +   ADGG     +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKL-EAADGGSKIKVSVT 118
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            F+TKGDA +P+E  +    ++  IFKA+E Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 119. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 91.1 bits 324,  Expect = 2e-20
 Identities = 58/155 37%, Positives = 92/155 59%, Gaps = 0/155 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E   TS V  A L+KA+  D DT++P+ LP + K  EI+EG+GG GT+K +++ 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +    K + +KI++ID+  + +SYSI+ G  L    + I     +    +GG     +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            +++KGDA   E+ +K    +++ +FKAVEAYLLAN
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 120. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 89.2 bits 317,  Expect = 5e-20
 Identities = 57/154 37%, Positives = 91/154 59%, Gaps = 0/154 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
            GV   E   TS V  A L+KA+  D DT++P+ LP + K  EI+EG+GG GT+K +++ +
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
                K + +KI++ID+  + +SYSI+ G  L    + I     +    +GG     +  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++KGDA   E+ +K    +++ +FKAVEAYLLAN
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 121. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 88.4 bits 314,  Expect = 9e-20
 Identities = 55/153 35%, Positives = 92/153 60%, Gaps = 2/153 1%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E  ITS+VP AKL+ A+  D D++ P+++   +K  EI+EG+GG GT+K +T+ 
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +    K + +K+++ID+  + ++YS++ G  L    + I     +V   +GG     T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            ++TKGDA   EE +K    +   +F+A+E Y+LAN
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153

Sequence Alignment: 122. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 85.6 bits 303,  Expect = 7e-19
 Identities = 56/154 36%, Positives = 88/154 57%, Gaps = 1/154 0%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            MGV   E  I S V  A L+KAL  D D ++P+ L  + K  E +EG+GG GT+K +T+ 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD-SFKSVENVEGNGGPGTIKKITFL 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
            +    K + +KI++ID+  + +SYS++ G  L    + I     +V   +GG     T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
            + TKGDA   ++ +K    + + +FKA+EAYLLA+
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAH 154

Sequence Alignment: 123. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 84.8 bits 300,  Expect = 1e-18
 Identities = 53/144 36%, Positives = 85/144 59%, Gaps = 1/144 0%
Query  11   TSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGDASPYKTMKQ 70
            TS V  A L+ AL  D D ++P+ + G+ +  EI+EG+GG GT+K +++ +    K + +
Sbjct  11   TSPVAPATLYNALAKDADNIIPKAV-GSFQSVEIVEGNGGPGTIKKISFVEDGETKFVLH 69
Query  71   KIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKGDAVVP 130
            KI+++D+  + +SYSI+ G  L    + I         ADGG     T  ++ KGDA   
Sbjct  70   KIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISYHGKGDAPPN 129
Query  131  EENIKFANDQNNLIFKAVEAYLLAN 155
            E+ +K    +++ +FKAVEAYLLAN
Sbjct  130  EDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 124. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 83.2 bits 294,  Expect = 3e-18
 Identities = 58/152 38%, Positives = 93/152 61%, Gaps = 5/152 3%
Query  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
            M V   E   TS V  A L+KAL  D DT++P+ +  + K  EI+EG+GG GT+K +++ 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
Query  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYID--SINNHLSFVPTADGGCTATST 118
            +    K + +KI+ ID+  + +SYSI+ G  L    +  SI++ LS  P  +GG     +
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGP--NGGSVVKLS 117
Query  119  AVFNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155
              +++KGDA   E+ +K    +++ +FK +EAYLLAN
Sbjct  118  IKYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 125. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 46.8 bits 152,  Expect = 1e-07
 Identities = 27/49 55%, Positives = 33/49 67%, Gaps = 0/49 0%
Query  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGG 50
            GV   E   TS +  A+LFKAL LD D L+ +VLP AIK  EI+EG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 126. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 46.6 bits 154,  Expect = 4e-07
 Identities = 41/132 31%, Positives = 70/132 53%, Gaps = 15/132 11%
Query  13   SVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVT-LGDASPYKTMKQK 71
            SV    L+  L  D  T++P+VLP  +K  +++EGDGGVGT+ +   L + SP    +++
Sbjct  12   SVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP-SYQREE 70
Query  72   IDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTA-DGGCTATSTAVFNTK----GD 126
            I   D+ +      +I+G    GY+   N  LS+  T            + N K     D
Sbjct  71   ITEFDESSHEIGLQVIEG----GYL---NQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
Query  127  AVVPEENIKFANDQNNLIF-KAVEAYL 152
            + + E+       Q+ L++ + +E YL
Sbjct  124  SDIEEKVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 127. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 40.6 bits 130,  Expect = 2e-05
 Identities = 20/75 26%, Positives = 38/75 50%, Gaps = 0/75 0%
Query  78   EAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKGDAVVPEENIKFA 137
            E   + Y  ++GD L   ++ I+    +V          +T+ ++TKGD  + EE++K  
Sbjct  18   EGSQYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAG 77
Query  138  NDQNNLIFKAVEAYL 152
             ++   +FK +E YL
Sbjct  78   KEKAAHLFKLIEGYL 92

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.