The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD
GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF
HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
Sequence Info Allergen Name Length Opt Bits Score E Value
P49372 Api g 1 154 977 210.2 2e-56
CAB03716 Dau c 1.0104 154 822 178.3 8.3e-47
CAB06416 Dau c 1.0105 154 819 177.7 1.3e-46
CAB03715 Dau c 1.0103 154 808 175.4 6.2e-46
BAA13604 Dau c 1.0102 154 804 174.6 1.1e-45
AAB01092 Dau c 1.0101 168 793 172.3 5.9e-45
CAA67246 Pet c PR10 155 620 136.6 2.8e-34
P92918 Api g 1.0201 159 514 114.8 1.1e-27
AAL76932 Dau c 1.0201 154 496 111.1 1.4e-26
O50001 Pru ar 1 160 468 105.3 7.9e-25
CAM31909 Act d 8.0101 157 457 103.1 3.7e-24
CAM31908 Act c 8.0101 159 448 101.2 1.4e-23
AAB92255 Tar o RAP 157 447 101.0 1.6e-23
B6CQS9 Pru du 1.0101 160 437 98.9 6.7e-23
CAD10374 Cas s 1 160 437 98.9 6.7e-23
CAA96535 Mal d 1.0401 160 436 98.7 7.7e-23
CAA96537 Mal d 1.0403 160 428 97.1 2.4e-22
CAA96536 Mal d 1.0402 160 428 97.1 2.4e-22
Q39427 Bet v 1.0205 160 427 96.9 2.8e-22
Q256S7 Fra a 1 160 426 96.7 3.2e-22
Q3T923 Fra a 1 160 425 96.5 3.7e-22
CAA54421 Bet v 1.0201 160 424 96.2 4.3e-22
P43186 Bet v 1.0204 160 423 96.0 4.9e-22
CAA54481 Bet v 1.0202 160 423 96.0 4.9e-22
P43184 Bet v 1.0203 160 422 95.8 5.7e-22
ACJ23864 Fag s 1.0101 160 421 95.6 6.5e-22
CAB02160 Bet v 1.0113 160 420 95.4 7.5e-22
CAA33887 Bet v 1.0101 160 419 95.2 8.7e-22
CAB02159 Bet v 1.0112 160 419 95.2 8.7e-22
CAB02156 Bet v 1.0109 160 418 95.0 1e-21
CAA07329.1 Bet v 1.0118 160 418 95.0 1e-21
CAB02161 Bet v 1.0114 160 418 95.0 1e-21
Q256S6 Fra a 1 160 417 94.8 1.2e-21
AAB24432 Aln g 1 160 416 94.6 1.3e-21
CAA04828.1 Bet v 1.0206 159 414 94.2 1.8e-21
Q256S4 Fra a 1 159 413 94.0 2e-21
Q256S2 Fra a 1 160 413 94.0 2e-21
CAA54484 Bet v 1.0104 160 411 93.6 2.7e-21
Q2I6V8 Pru p 1.0101 160 411 93.6 2.7e-21
P38948 Aln g 1 159 409 93.2 3.6e-21
O24248 Pru av 1 160 409 93.2 3.6e-21
CAB02217 Car b 1.0302 161 409 93.2 3.7e-21
NP_001275580 Sola l 4.0201 160 408 93.0 4.2e-21
CAB02157 Bet v 1.0110 160 408 93.0 4.2e-21
CAA54483 Bet v 1.0103 160 408 93.0 4.2e-21
CAA54487 Bet v 1.0106 160 408 93.0 4.2e-21
CAB02216 Car b 1.0301 161 407 92.7 4.9e-21
AFN42528 Can s 5.0101 161 407 92.7 4.9e-21
CAA54482 Bet v 1.0102 160 406 92.5 5.6e-21
APD76154 Jug r 5.0101 160 406 92.5 5.6e-21
CAA07323.1 Bet v 1.0117 160 406 92.5 5.6e-21
CAA96547 Bet v 1.0115 160 406 92.5 5.6e-21
AAO25113 Mal d 1.0304 159 405 92.3 6.4e-21
CAB02155 Bet v 1.0108 160 405 92.3 6.4e-21
ABZ81046 Que a 1.0301 160 405 92.3 6.4e-21
AAK13027 Mal d 1.0302 159 404 92.1 7.4e-21
CAA04827.1 Bet v 1.0116 159 404 92.1 7.4e-21
AUH28179 Que m 1.0101 160 404 92.1 7.4e-21
CAB02158 Bet v 1.0111 160 403 91.9 8.6e-21
CAA54696.1 Bet v 1.0301 160 401 91.5 1.1e-20
CAA54489 Bet v 1.0107 160 401 91.5 1.1e-20
CAA96549 Cor a 1.0301 160 401 91.5 1.1e-20
CAA96534 Mal d 1.0301 159 400 91.3 1.3e-20
ACF75030.1 Bet v 1.0207 150 399 91.1 1.4e-20
CAA96548 Cor a 1.0201 160 399 91.1 1.5e-20
QGS84240 Que i 1.0101 159 397 90.7 2e-20
CAA54485 Bet v 1.0105 160 396 90.5 2.3e-20
CAB02208 Car b 1.0105 160 395 90.3 2.7e-20
CAB02209 Car b 1.0106 160 395 90.3 2.7e-20
AAK13028 Mal d 1.0303 159 392 89.7 4.1e-20
CAB02206 Car b 1.0103 160 392 89.7 4.1e-20
CAB02207 Car b 1.0104 160 392 89.7 4.1e-20
ABZ81047 Que a 1.0401 160 392 89.7 4.1e-20
ABZ81042 Car b 1.0111 160 392 89.7 4.1e-20
ABZ81043 Car b 1.0112 160 392 89.7 4.1e-20
ABZ81040 Car b 1.0109 160 391 89.5 4.7e-20
ABZ81041 Car b 1.0110 160 391 89.5 4.7e-20
CAB02213 Car b 1.0107 160 390 89.2 5.5e-20
CAB02215 Car b 1.0108 160 390 89.2 5.5e-20
AAD13683 Mal d 1.0206 159 388 88.8 7.2e-20
CAA50325 Cor a 1.0103 160 387 88.6 8.4e-20
ADK39021 Ost c 1.0101 160 386 88.4 9.7e-20
ABZ81044 Car b 1.0113 160 386 88.4 9.7e-20
CAA50327 Cor a 1.0101 160 381 87.4 2e-19
ABC41615.1 Bet v 1.0119 150 380 87.2 2.1e-19
AAB01362 Mal d 1.0201 159 380 87.2 2.3e-19
AAD26545 Mal d 1.0202 159 380 87.2 2.3e-19
ABZ81045 Que a 1.0201 159 378 86.8 3e-19
AAK13030 Mal d 1.0207 159 377 86.6 3.5e-19
AAD26548 Mal d 1.0204 159 376 86.4 4e-19
AAD26554 Mal d 1.0106 159 375 86.2 4.6e-19
CAA58646 Mal d 1.0101 159 375 86.2 4.6e-19
O65200 Pyr c 1 159 375 86.2 4.6e-19
CAA50328 Cor a 1.0102 160 375 86.2 4.7e-19
CAD32318 Mal d 1.0208 158 374 86.0 5.3e-19
CAA47357 Car b 1.0102 159 374 86.0 5.3e-19
AAD26547 Mal d 1.0203 159 374 86.0 5.3e-19
Q08407 Cor a 1 159 374 86.0 5.3e-19
AAD29671 Mal d 1.0108 159 374 86.0 5.3e-19
AAD26546 Mal d 1.0103 159 374 86.0 5.3e-19
AAK13029 Mal d 1.0109 159 373 85.7 6.2e-19
P38950 Car b 1 159 373 85.7 6.2e-19
AAD26552 Mal d 1.0104 159 372 85.5 7.1e-19
AAD26558 Mal d 1.0205 159 372 85.5 7.1e-19
AAD26553 Mal d 1.0105 159 372 85.5 7.1e-19
CAA50326 Cor a 1.0104 160 372 85.5 7.2e-19
AAG40331 Cor a 1.0404 161 371 85.3 8.3e-19
CAA88833 Mal d 1.0102 159 370 85.1 9.4e-19
QOL10866 Que ac 1.0101 159 370 85.1 9.4e-19
AAD48405 Cor a 1.0401 161 368 84.7 1.3e-18
AAG40329 Cor a 1.0402 161 367 84.5 1.5e-18
P38949 Car b 1 159 365 84.1 1.9e-18
AAD26555 Mal d 1.0107 159 365 84.1 1.9e-18
AAG40330 Cor a 1.0403 161 364 83.9 2.3e-18
AHC08073 Sola l 4.0101 160 358 82.7 5.3e-18
CAA43637 Pha v 1 156 346 80.2 2.8e-17
EF436550 Ara h 8.0201 153 345 80.0 3.2e-17
Q0Z8U9 Rub i 1.0101 137 339 78.8 6.5e-17
P25985 Pha v 1 155 339 78.7 7.7e-17
Q2VU97 Vig r 1.0101 155 333 77.5 1.8e-16
CAA42646 Gly m 4 158 329 76.7 3.3e-16
CAA43636 Pha v 1 155 328 76.5 3.7e-16
CAA75803 Lyc e 4.0101 178 322 75.2 1e-15
AAQ91847 Ara h 8.0101 157 319 74.6 1.4e-15
Q5ULZ4 Fra a 1.0101 100 170 44.1 1.3e-06
P85126 Que a 1.0101 50 124 34.9 0.00038
Q9ZWP8 Vig r 6.0101 155 112 32.0 0.0092
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 210.2 bits 977,  Expect = 2e-56
 Identities = 154/154 100%, Positives = 154/154 100%, Gaps = 0/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
            MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF
Sbjct  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
Sbjct  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 2. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 178.3 bits 822,  Expect = 8e-47
 Identities = 125/154 81%, Positives = 143/154 92%, Gaps = 0/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
            MG Q+H LE+TSSVSAEKIF G V+DVDTV+PKAAPGAYKSV++KGDGG GT++IITLP+
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G PIT+MT+R D VNKEALT+D +VIDGDILLGFIESIE H+V+VPTADGGSI KTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGDAVVPEENIK+A+EQNTALFKA+EAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 3. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 177.7 bits 819,  Expect = 1e-46
 Identities = 125/154 81%, Positives = 142/154 92%, Gaps = 0/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
            MG Q+H LE+TSSVSAEKIF G V+DVDTV+PKAAPGAYKSVE+KGDGG GT++IITLP+
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEVKGDGGAGTVRIITLPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G PIT+MT+R D VNKEALT+D +VIDGDILLGFIESIE H+V+VPTADGGSI KTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGDAVVPEENIK+A+ QNTALFKA+EAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 4. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 175.4 bits 808,  Expect = 6e-46
 Identities = 124/154 80%, Positives = 141/154 91%, Gaps = 0/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
            MG Q+H LE+TSSVSAEKIF G V+DVDTV+PKAA GAYKSVE+KGDGG GT++IITLP+
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G PITTMT+R D VNKEAL++D +VIDGDILLGFIESIE H+V+VPTADGGSI KTTAIF
Sbjct  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGDAVVPEENIK+A+ QNTALFKA+EAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 5. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 174.6 bits 804,  Expect = 1e-45
 Identities = 123/154 79%, Positives = 141/154 91%, Gaps = 0/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
            MG Q+H LE+TSSVSAEKIF G V+DVDTV+PKAAPGAYKSV++KGDGG GT++IITLP+
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G PIT+MT+R D VNKEALT+D +VIDGDILL FIESIE H+V+VPTADGGSI KTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGDAVVPEENIK+A+ QNTALFKA+EAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 6. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 172.3 bits 793,  Expect = 6e-45
 Identities = 122/154 79%, Positives = 140/154 90%, Gaps = 0/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
            MG Q+H LE+TSSVSAEKIF   V+DVDTV+PKAAPGAYKSV++KGDGG GT++IITLP+
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 74
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G PIT+MT+R D VNKEALT+D +VIDGDILL FIESIE H+V+VPTADGGSI KTTAIF
Sbjct  75   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 134
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGDAVVPEENIK+A+ QNTALFKA+EAYLIAN
Sbjct  135  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 7. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 136.6 bits 620,  Expect = 3e-34
 Identities = 93/154 60%, Positives = 123/154 79%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGVQ   + +TSSV A K+F+ + +D+DT+LP+  PGA K  EI +GDGG GT+K++TL 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            D  P  TM  +ID ++KEA+TF YS+IDGDILLG+I+SI NH+ +VPTADGG    +TA+
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            F+TKGDAVVPEENIK+AN+QN  +FKA+EAYL+AN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 8. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 114.8 bits 514,  Expect = 1e-27
 Identities = 82/153 53%, Positives = 113/153 73%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGVQ  V+E  S+VSAEK++QGF++D+DTV+PK  P   KSVEI +GDGG GT+K++ L 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +    TTM  ++D ++K  L + Y+ I GDIL+  +ES+ N  V+VPT DGG I K T I
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGDAV+PE+ IK A E++   FKA+EAYL+AN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 9. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 111.1 bits 496,  Expect = 1e-26
 Identities = 79/153 51%, Positives = 113/153 73%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGVQ   +E  S+VSAEK++QGF++D+DTV+PK  P   KSVEI +GDGG GT++++ L 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +    TTM  ++D ++K  L + Y+ I GDIL+  +ES+ N+ V+VPT DGG I K T I
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGDAV+PE+ +K A E++   FKA+EAYL+AN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 10. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 105.3 bits 468,  Expect = 8e-25
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS +  EK+F+ F++D D ++PK AP A K  EI +GDGG GT+K +T+ 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+DG++K+ L++ Y++I+GD L   IE+I   + LV + DGGSI KTT+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  + EE +K   E+   LFK +EAYL+AN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155

Sequence Alignment: 11. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 103.1 bits 457,  Expect = 4e-24
 Identities = 74/153 48%, Positives = 107/153 69%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MG  T+ +E+ SS+SAEK+F+ FV+D DT++PKA P A   V+ ++GDGG GT+K+ T+ 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G    ++  RIDG++KE +T+ YS+I+G  L  F ESI  H+ +V T DGG ICK  +I
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVF-ESISYHIKIVATPDGGCICKNRSI 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +  K DA V EE IK   E+ + +FK +EAYL+AN
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 12. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 101.2 bits 448,  Expect = 1e-23
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+ +E+ S V   K+++ F++D DT++PK  P A K V+I +GDG  GT+K +T+ 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+D ++K+ LT+ Y++I+GD+L    ESI  H+ +V   DGGSICK  +I
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            + TKGD  V EE IK   E+   +FKALEAYL+AN
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 13. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 101.0 bits 447,  Expect = 2e-23
 Identities = 65/147 44%, Positives = 101/147 68%, Gaps = 1/147 0%
Query  8    LELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPDGGPITT 66
            +E+TSS+S   IF+ FVID DT+ PKA P  YKS++ I+GDGG GT+K IT  DG P T+
Sbjct  6    FEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTS 65
Query  67   MTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDA 126
               ++D ++   ++  Y++ +GD+L+G IES  +H+ ++P+ADGGS+ K + +F  KGDA
Sbjct  66   SKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDA 125
Query  127  VVPEENIKYANEQNTALFKALEAYLIAN 154
             + +EN+    E     FKA+E Y+I++
Sbjct  126  KLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 14. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 98.9 bits 437,  Expect = 7e-23
 Identities = 65/154 42%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MG+ T+  E TS +   ++F+ +V++ DT++PK AP + KS EI +GDGG GT+K I++ 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G   + +  +IDG++K+ + ++YS+++GD L   +E I   + LV +ADGGS+ K+T+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  + EE++K   E+ T LFK +E YL+AN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVAN 155

Sequence Alignment: 15. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 98.9 bits 437,  Expect = 7e-23
 Identities = 68/154 44%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV TH  E+TS++   ++F+ FV+D D ++PK AP A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++  +T+ YSVI+GD++  ++E I   + +V + DGGSI K T+ 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  + EE +    E+   LFKA+EAYL+A+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 16. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 98.7 bits 436,  Expect = 8e-23
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A KS EI +GDGG GT+K +T+ 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R++G++K+ +T+ YS+I+GD L   +E I     L+ + DGGSI KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +H KGD  + EE++K   E+ + LFK LEAYL+A+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 17. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 97.1 bits 428,  Expect = 2e-22
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  E+TS + A ++F+ F++D D ++PK AP A KS EI +GDGG GT+K +T+ 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R++G++K+ +T+ YS+I+GD L   +E I     L+ + DGGSI KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +  KGD  + EE++K   E+ + LFK LEAYL+A+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 18. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 97.1 bits 428,  Expect = 2e-22
 Identities = 65/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  E+TS + A ++F+ F++D D ++PK AP A KS +I +GDGG GT+K +T+ 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R++G++K+ +T+ YS+I+GD L   +E I     L+ + DGGSI KT + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +H KGD  + EE++K   E+ + LFK LEAYL+A+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 19. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 96.9 bits 427,  Expect = 3e-22
 Identities = 67/154 43%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YS+I+G  L   +E I N + LV T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 20. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 96.7 bits 426,  Expect = 3e-22
 Identities = 69/151 45%, Positives = 98/151 64%, Gaps = 1/151 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +I  ++KE  T+ YS+I+GD L   IE I+    LV    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 96.5 bits 425,  Expect = 4e-22
 Identities = 68/151 45%, Positives = 98/151 64%, Gaps = 1/151 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +I  ++KE  T+ YS+I+GD L   IE I+    LV    GG++ KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 22. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 96.2 bits 424,  Expect = 4e-22
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F+++ DT++PK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YS+I+G  L   +E I N + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 23. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 96.0 bits 423,  Expect = 5e-22
 Identities = 66/154 42%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YS+I+G  L   +E I N + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 24. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 96.0 bits 423,  Expect = 5e-22
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F+++ DT++PK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YS+I+G  L   +E I N + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 25. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 95.8 bits 422,  Expect = 6e-22
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F+++ DT++PK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YS+I+G  L   +E I N + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 26. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 95.6 bits 421,  Expect = 7e-22
 Identities = 66/154 42%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E T+ ++  ++F+ FV+D D ++PK AP A KS EI +G GGPGT+K IT+ 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID ++   +T+  ++I+GD +   +E I   + LV + DGGSI K+T+ 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  + E+ IK   E+ + +FKA+EAYL+AN
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155

Sequence Alignment: 27. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 95.4 bits 420,  Expect = 8e-22
 Identities = 65/154 42%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 28. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 95.2 bits 419,  Expect = 9e-22
 Identities = 65/154 42%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 29. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 95.2 bits 419,  Expect = 9e-22
 Identities = 65/154 42%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGGSI K +  
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 30. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 95.0 bits 418,  Expect = 1e-21
 Identities = 65/154 42%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 31. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 95.0 bits 418,  Expect = 1e-21
 Identities = 65/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + LV T DGGSI + +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 32. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 95.0 bits 418,  Expect = 1e-21
 Identities = 65/154 42%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 33. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 94.8 bits 417,  Expect = 1e-21
 Identities = 68/151 45%, Positives = 97/151 64%, Gaps = 1/151 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MG  T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +I  ++KE  T+ YS+I+GD L   IE I+    LV    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 34. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 94.6 bits 416,  Expect = 1e-21
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ F++D D +LPK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V++  + + +SVI+G  +   +E + N + +V   DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FHTKGD  +  E IK   E+   L+KA+E+YL+A+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 35. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 94.2 bits 414,  Expect = 2e-21
 Identities = 65/153 42%, Positives = 100/153 65%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K IT+P+
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G P   +  R+D V+   + + YS+I+G  L   +E I N + LV T DGGSI K +  +
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGD  +  E++K   E+   L++A+E+YL+A+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 36. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 94.0 bits 413,  Expect = 2e-21
 Identities = 69/150 46%, Positives = 99/150 66%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +I  ++KE  T+ YS+I+GD L   IE I+    LV +A  G+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLV-SAPHGTIIKTTSK 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151

Sequence Alignment: 37. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 94.0 bits 413,  Expect = 2e-21
 Identities = 68/151 45%, Positives = 96/151 63%, Gaps = 1/151 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +I  ++K   T+ YS+I+GD L   IE I+    LV    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYL 152

Sequence Alignment: 38. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 93.6 bits 411,  Expect = 3e-21
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  + +E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YSVI+G  +   +E I N + +V T +GGSI K    
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 39. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 93.6 bits 411,  Expect = 3e-21
 Identities = 65/151 43%, Positives = 98/151 64%, Gaps = 1/151 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID ++KE  ++ Y++I+GD L   +E I     LV +  GGSI K+T+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 40. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 93.2 bits 409,  Expect = 4e-21
 Identities = 64/153 41%, Positives = 98/153 64%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  +  E  S + A ++F+ F++D D +LPK AP A  SVE I+G+GGPGT+K IT+P+
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G P   +  R+D V++  + + +SVI+G  +   +E + N + +V   DGGSI K +  F
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGD  +  E IK   E+   L+KA+E+YL+A+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 41. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 93.2 bits 409,  Expect = 4e-21
 Identities = 64/151 42%, Positives = 98/151 64%, Gaps = 1/151 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID ++KE  ++ Y++I+GD L   +E I     LV +  GGSI K+T+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+ + LFK +E YL
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 42. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 93.2 bits 409,  Expect = 4e-21
 Identities = 64/154 41%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D + ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P+  +  R++ V+   + + Y+VI+G  +   +E I N + +V   DGGSI K T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  VP E+IK   E+   L+K +EAYL+A+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 43. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 93.0 bits 408,  Expect = 4e-21
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E T++++  ++F+G+V+D D+++PK      KS+EI +GDGG G++K + + 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +GGPI  +  +I  ++ + L   YS+I+GD+L   +ESI   V +    DGG +CKTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD VV EE       +   LFKA+EAYL+AN
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155

Sequence Alignment: 44. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 93.0 bits 408,  Expect = 4e-21
 Identities = 62/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 45. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 93.0 bits 408,  Expect = 4e-21
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YSVI+G  +   +E I N + +V T +GGSI K    
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 46. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 93.0 bits 408,  Expect = 4e-21
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + YSVI+G  +   +E I N + +V T +GGSI K    
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 47. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 92.7 bits 407,  Expect = 5e-21
 Identities = 63/154 40%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D + ++PK +P A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P+  +  R++ V+   + + Y+VI+G  +   +E I N + +V   DGGSI K T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  VP E+IK   E+   L+K +EAYL+A+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 48. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 92.7 bits 407,  Expect = 5e-21
 Identities = 66/151 43%, Positives = 104/151 68%, Gaps = 2/151 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TSS++  ++F+ FV+D D ++PK AP A + VEI +G+GG GT+K IT+ 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGF-IESIENHVVLVPTADGGSICKTTA 118
             G P   +  +I+ ++KE+LT+ YS+I+GD L G  +E I +   LV + DGG++ KT +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  IFHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
             +++ GDA V EE +K   +Q T ++K +EAYL
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYL 153

Sequence Alignment: 49. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 92.5 bits 406,  Expect = 6e-21
 Identities = 62/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  + +E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I +P
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 50. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 92.5 bits 406,  Expect = 6e-21
 Identities = 64/154 41%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E TS +   ++F+ FV+D D ++PK  P A KS EI +G+GGPGT+K I + 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R D +++  +T+ YSVI+GD L   IE I     +V + +GGSI K+ + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +H+KGD  + EE++K   E+ + LFKA+E YL+A+
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 51. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 92.5 bits 406,  Expect = 6e-21
 Identities = 62/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 52. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 92.5 bits 406,  Expect = 6e-21
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V  + + + YSVI+G  +   +E I N + +V T DG SI K +  
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 53. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 92.3 bits 405,  Expect = 6e-21
 Identities = 67/151 44%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS +   ++F  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G   + +  RIDGV+KE + + YSVI+GD +   IE I     LV +  G S+ K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLI 152
            +HTKGD  + EE++K   E+ + LFK +E YL+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 54. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 92.3 bits 405,  Expect = 6e-21
 Identities = 62/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 55. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 92.3 bits 405,  Expect = 6e-21
 Identities = 64/154 41%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E  S +   ++F+ FV+D D ++PK  P A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G  +     RID ++ E +T+ +SVI+GD L+  +E++     +V + DGGSI K+T+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGD  + +E I+   E+ + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155

Sequence Alignment: 56. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 92.1 bits 404,  Expect = 7e-21
 Identities = 67/151 44%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+  E+TS +   ++F  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G   + +  RIDGV+K+ + + YSVI+GD +   IE I     LV  A  GS+ K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLI 152
            +HTKGD  + EE++K   E+ + LFK +E YL+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 57. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 92.1 bits 404,  Expect = 7e-21
 Identities = 63/153 41%, Positives = 99/153 64%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P+
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G P   +  R+D V+   + + YS+I+G  +   +E I N + +V T DGGSI K +  +
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            HTKGD  V  E +K + E    L++A+E+YL+A+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 58. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 92.1 bits 404,  Expect = 7e-21
 Identities = 64/154 41%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  E  S +   ++F+ FV+D D ++PK  P A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G  +     RID ++ E +TF +SVI+GD L+  +E++     +V + DGGSI K+T  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGD  + +E I+   E+ + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 59. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 91.9 bits 403,  Expect = 9e-21
 Identities = 62/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
             G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 60. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 91.5 bits 401,  Expect = 1e-20
 Identities = 64/154 41%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS ++  ++F+ FV+D D ++PK AP    S E I+G+GGPGT+K IT+P
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     M  R+D ++   + + YS+I+G  L   +E I   + +V    GGSI K T+ 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  + EE IK   E+   LFKA+E YL+A+
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAH 155

Sequence Alignment: 61. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 91.5 bits 401,  Expect = 1e-20
 Identities = 62/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I +P
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 62. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 91.5 bits 401,  Expect = 1e-20
 Identities = 61/154 39%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  E TS +   ++F+ FV+D D ++PK AP A KS+EI +G+GGPGT+K I + 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  +++ +++  +++ YSVI+GD L   +E I   + +V +  GGSI K+ + 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HT GD  + +E IK   E+ + LFKA+E YL+A+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 63. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 91.3 bits 400,  Expect = 1e-20
 Identities = 66/153 43%, Positives = 98/153 64%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  E+TS +   ++F  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G   + +  RIDGV+KE + + YSVI+GD +   IE I     LV +  G S+ K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTK D  + EE++K   E+ + LFK +E YL+A+
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 64. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 91.1 bits 399,  Expect = 1e-20
 Identities = 61/144 42%, Positives = 96/144 66%, Gaps = 1/144 0%
Query  9    ELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPDGGPITTM 67
            E TS + A ++F+ F+++ D ++PK AP A  SVE I+G+GGPGT+K IT+P+G P   +
Sbjct  6    ETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYV 65
Query  68   TLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAV 127
              R+D V+   + + YS+I+G  L   +E I N + +V T DGGSI K +  +HTKGD  
Sbjct  66   KERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHE 125
Query  128  VPEENIKYANEQNTALFKALEAYLI 152
            +  E++K   E+  AL++A+E+YL+
Sbjct  126  MKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 65. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 91.1 bits 399,  Expect = 2e-20
 Identities = 63/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F++D + ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R++ V+   + + Y+VI+G  +   +E I N + +V   DGGSI K +  
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD  V  E+IK   E+   LF+A+EAYL+A+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 66. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 90.7 bits 397,  Expect = 2e-20
 Identities = 66/153 43%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV TH  + TS +   ++F+ FV+D D ++PK  P A KS+E I+G+GGPGT+K IT+ 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +         RID ++ E  T+ +SVI+GD L   + S+   + +V + DGGSI K+T  
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGD  + EE I+   E+ T L KA+EAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154

Sequence Alignment: 67. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 90.5 bits 396,  Expect = 2e-20
 Identities = 61/154 39%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ F+++ D ++PK AP A  SVE I+G+GGPGT+K I +P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 68. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 90.3 bits 395,  Expect = 3e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 69. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 90.3 bits 395,  Expect = 3e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 70. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 89.7 bits 392,  Expect = 4e-20
 Identities = 63/151 41%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T+ +E+TS +   +++  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G   + +  +IDGV+K+ + + YSVI+GD +   IE I     LV +  G S+ K+ + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSG-SVIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLI 152
            +HTKGD  + EE++K   E+ + LFK +E YL+
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 71. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 89.7 bits 392,  Expect = 4e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 72. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 89.7 bits 392,  Expect = 4e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 73. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 89.7 bits 392,  Expect = 4e-20
 Identities = 62/154 40%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV TH  + TS ++  ++F+ + +D D ++ K  P A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G  +     RID ++ E +T+ +SVI+GD L+  +E++     +V + DGGSI K+T+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGD  + +E I+   E+ + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 74. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 89.7 bits 392,  Expect = 4e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 75. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 89.7 bits 392,  Expect = 4e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 76. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 89.5 bits 391,  Expect = 5e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 77. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 89.5 bits 391,  Expect = 5e-20
 Identities = 60/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGS+ K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 78. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 89.2 bits 390,  Expect = 5e-20
 Identities = 62/154 40%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + F Y+VI+GD+L   +E +   + +V    GGSI K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 79. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 89.2 bits 390,  Expect = 5e-20
 Identities = 62/154 40%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + F Y+VI+GD+L   +E +   + +V    GGSI K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 80. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 88.8 bits 388,  Expect = 7e-20
 Identities = 63/150 42%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+GFV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 81. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 88.6 bits 387,  Expect = 8e-20
 Identities = 62/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+D V+   +T+ Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  +  E IK A E    L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 82. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 88.4 bits 386,  Expect = 1e-19
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A   VE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 83. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 88.4 bits 386,  Expect = 1e-19
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G P   +  R+D V+   + + Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 84. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 87.4 bits 381,  Expect = 2e-19
 Identities = 60/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  + +E  S + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+D V+   +T+ Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 85. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 87.2 bits 380,  Expect = 2e-19
 Identities = 58/144 40%, Positives = 93/144 64%, Gaps = 1/144 0%
Query  9    ELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPDGGPITTM 67
            E TS + A ++F+ F++D D ++PK AP A  SV+ I+G+GGPGT+K I +P+G P   +
Sbjct  6    ETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFPFKYV 65
Query  68   TLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAV 127
              R+D V+   + ++YSVI+G  +   +E I N + +V T DGG I K +  +HTKG+  
Sbjct  66   KDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTKGNHE 125
Query  128  VPEENIKYANEQNTALFKALEAYLI 152
            V  E +K + E    L++A+E+YL+
Sbjct  126  VKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 86. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 87.2 bits 380,  Expect = 2e-19
 Identities = 62/150 41%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 87. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 87.2 bits 380,  Expect = 2e-19
 Identities = 62/150 41%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 88. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 86.8 bits 378,  Expect = 3e-19
 Identities = 64/153 41%, Positives = 98/153 64%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV TH  + TS ++  ++F+ + +D D ++ K  P A KS EI +G+GGPGT+K IT+ 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +         RID ++ E  T+ +SVI+GD L   +ES+   +  V + DGGSI K+T  
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKGD  + EE I+ A E+   L+KA+EAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154

Sequence Alignment: 89. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 86.6 bits 377,  Expect = 3e-19
 Identities = 62/150 41%, Positives = 92/150 61%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 90. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 86.4 bits 376,  Expect = 4e-19
 Identities = 61/150 40%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     L+ +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 91. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 86.2 bits 375,  Expect = 5e-19
 Identities = 60/150 40%, Positives = 95/150 63%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE+I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 92. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 86.2 bits 375,  Expect = 5e-19
 Identities = 60/150 40%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 93. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 86.2 bits 375,  Expect = 5e-19
 Identities = 59/150 39%, Positives = 95/150 63%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MG+ T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+D +++ + ++ Y++I+GD L   IE I     LV +  G +I K+ + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 94. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 86.2 bits 375,  Expect = 5e-19
 Identities = 59/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  + +E  S + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+D V+   + + Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 95. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 86.0 bits 374,  Expect = 5e-19
 Identities = 61/149 40%, Positives = 93/149 62%, Gaps = 2/149 1%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLPD 60
            GV T+  E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ +
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISHY 119
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            HTKGD  + EE++K   E+   LFK +E+YL
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYL 150

Sequence Alignment: 96. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 86.0 bits 374,  Expect = 5e-19
 Identities = 59/153 38%, Positives = 96/153 62%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ +
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ F
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            H KG   V  E +K A E    L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 97. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 86.0 bits 374,  Expect = 5e-19
 Identities = 61/150 40%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++K   E+   LFK +E++L
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHL 151

Sequence Alignment: 98. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 86.0 bits 374,  Expect = 5e-19
 Identities = 59/153 38%, Positives = 97/153 63%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  + +E  S + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ +
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G     +  R+D V+   +T+ Y+VI+GD+L   +E + + + +V    GGSI K ++ F
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            H KGD  +  E +K A E    L++A+E YL+A+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 99. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 86.0 bits 374,  Expect = 5e-19
 Identities = 60/150 40%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 100. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 86.0 bits 374,  Expect = 5e-19
 Identities = 60/150 40%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 101. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 85.7 bits 373,  Expect = 6e-19
 Identities = 60/150 40%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 85.7 bits 373,  Expect = 6e-19
 Identities = 56/153 36%, Positives = 99/153 64%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  +  E TS + A ++F+ F++D + ++PK +P A  SVE ++G+GGPGT+K IT+ +
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G P+  +  R++ ++   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ F
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            H KG   V  E +K A E    L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 103. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 85.5 bits 372,  Expect = 7e-19
 Identities = 60/150 40%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 104. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 85.5 bits 372,  Expect = 7e-19
 Identities = 61/150 40%, Positives = 92/150 61%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKGD  + EE++    E+   LFK +E+YL
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151

Sequence Alignment: 105. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 85.5 bits 372,  Expect = 7e-19
 Identities = 60/150 40%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 106. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 85.5 bits 372,  Expect = 7e-19
 Identities = 59/154 38%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  + +E  S +SA ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  R+D V+   + + Y+VI+GD+L   +E + + + +V    GGS  K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 107. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 85.3 bits 371,  Expect = 8e-19
 Identities = 60/154 38%, Positives = 96/154 62%, Gaps = 2/154 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV ++  E TS +   ++F+ FV+D D ++PK AP  + S E ++G+GGPGT+K IT+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGG-SICKTTA 118
            +G     M  +++ ++   + + YS+I+G  L   +E I   + +     GG SI K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  IFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
             +HTKG+A + EE IK   E+   LFKA+EAYL+A+
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 108. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 85.1 bits 370,  Expect = 9e-19
 Identities = 59/150 39%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +H KG+  + EE++K   E+   LFK +E+YL
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYL 151

Sequence Alignment: 109. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 85.1 bits 370,  Expect = 9e-19
 Identities = 64/153 41%, Positives = 97/153 63%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV  +  + TS +   ++F+ FV+D D ++ K  P A KS EI +G+GGPGT+K  T+ 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +   +     RID ++ E  ++ +SVI+G+ L   I SI   V +V + DGGSI K+T  
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            ++TKG   + EE I+ A E+ T LFKA+EAYL+A+
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154

Sequence Alignment: 110. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 84.7 bits 368,  Expect = 1e-18
 Identities = 60/154 38%, Positives = 95/154 61%, Gaps = 2/154 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS +   ++F+ FV+D D ++PK AP  + S E ++G+GGPGT+K IT+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGG-SICKTTA 118
            +G     M  +++ ++   + + YS+I+G  L   +E I   + +     GG SI K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  IFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
             +HTKG+A + EE IK   E+   LFKA+EAYL+A+
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 111. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 84.5 bits 367,  Expect = 1e-18
 Identities = 59/154 38%, Positives = 95/154 61%, Gaps = 2/154 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV ++  E TS +   ++F+ FV+D D ++PK AP  +   E ++G+GGPGT+K IT+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGG-SICKTTA 118
            +G     M  +++ ++   + + YS+I+G  L   +E I   + +     GG SI K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  IFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
             +HTKG+A + EE IK   E+   LFKA+EAYL+A+
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 112. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 84.1 bits 365,  Expect = 2e-18
 Identities = 58/153 37%, Positives = 95/153 62%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
            GV  +  E  S + A ++F+ +V+D D ++PK AP    SVE + G+GGPGT+K IT+ +
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
            G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ F
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            H KG   V  E +K A E    L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 113. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 84.1 bits 365,  Expect = 2e-18
 Identities = 59/150 39%, Positives = 92/150 61%, Gaps = 2/150 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151
            +HTKG+  + EE++K    +   LFK +E+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYL 151

Sequence Alignment: 114. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 83.9 bits 364,  Expect = 2e-18
 Identities = 59/154 38%, Positives = 94/154 61%, Gaps = 2/154 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV  +  E TS +   ++F+ FV+D D ++PK AP  +   E ++G+GGPGT+K IT+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGG-SICKTTA 118
            +G     M  +++ ++   + + YS+I+G  L   +E I   + +     GG SI K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  IFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
             +HTKG+A + EE IK   E+   LFKA+EAYL+A+
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 115. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 82.7 bits 358,  Expect = 5e-18
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV T+  E T+++S  ++F+ +V+D D ++PK      K+ E I+GDGG G++K + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +GGPI  +  +I  ++ + L   YS+I+GDIL   +ESI   + +    +GG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGD VV EE      E+   + KA+EAYL+AN
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 80.2 bits 346,  Expect = 3e-17
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   + TS V+   +++    D DT++PKA P ++KSVEI +G+GGPGT+K I++ 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            + G    +  +I+ +++  L + YS++ G  L    E I     L    +GGS+ K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +H+KGDA   E+ +K    ++ +LFKA+EAYL+AN
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 80.0 bits 345,  Expect = 3e-17
 Identities = 60/150 40%, Positives = 96/150 64%, Gaps = 7/150 4%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV+T   E TS V   K+F+  V+D D + PK  P A +S+EI +G+GGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIE--NHVVLVPTADGGSICKTT 117
            + G  + +  +ID +++   T+DY++  G    GF E +E  +    +  ADGGS  K +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGG---TGFQEILEKVSFKTKLEAADGGSKIKVS 116
Query  118  AIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
              FHTKGDA +P+E  +   +++  +FKA+E Y+++N
Sbjct  117  VTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 118. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 78.8 bits 339,  Expect = 7e-17
 Identities = 59/134 44%, Positives = 84/134 62%, Gaps = 2/134 1%
Query  11   TSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLPDGGPITTMTL 69
            TS +   K+F+ FV+D D ++PK AP A KSVEI +GDGG GT+K I L +G   + +  
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  70   RIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVP 129
            +IDG++K  + + YS+ +GD L   IE I   + LV +  G SI KTT+ +H KG A + 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEIK 120
Query  130  EENIKYANEQNTALFK 145
            EE +K   E+   LFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 119. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 78.7 bits 339,  Expect = 8e-17
 Identities = 57/153 37%, Positives = 93/153 60%, Gaps = 1/153 0%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLPD 60
            GV T   + TS V+   +++    D DT++PKA P ++KSVEI +G+GGPGT+K I++ +
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
             G    +  +I+ +++  L + YS++ G  L    E I     L    +GGS+ K +  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            H+KGDA   E+ +K    ++ +LFKA+EAYL+AN
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 77.5 bits 333,  Expect = 2e-16
 Identities = 59/153 38%, Positives = 92/153 60%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            M V T   + TS V+   ++  +  D D ++PKA  G+++SVEI +G+GGPGT+K I++ 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAV-GSFQSVEIVEGNGGPGTIKKISFV 59
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            + G    +  +I+ V++  L + YS++ G  L    E I     +   ADGGS+ K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +H KGDA   E+ +K    ++ ALFKA+EAYL+AN
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 121. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 76.7 bits 329,  Expect = 3e-16
 Identities = 60/153 39%, Positives = 92/153 60%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV T   E+ S V+   +++ +V D D V+PKA   ++KSVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD-SFKSVENVEGNGGPGTIKKITFL 59
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            + G    +  +I+ +++  L + YSV+ G  L    E I     LV   +GGS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            + TKGDA   ++ +K    +  ALFKA+EAYL+A+
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAH 154

Sequence Alignment: 122. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 76.5 bits 328,  Expect = 4e-16
 Identities = 57/153 37%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            M V T   + TS V+   +++ +V D DT++PKA   ++KSVEI +G+GGPGT+K I++ 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            + G    +  +I+ +++  L + YS++ G  L    E I     L    +GGS+ K +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +H+KGDA   E+ +K    ++ ALFK +EAYL+AN
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 123. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 75.2 bits 322,  Expect = 1e-15
 Identities = 54/145 37%, Positives = 87/145 60%, Gaps = 1/145 0%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
            MGV T+  E T+++S  ++F+ +V+D D ++PK      K+ E I+GDGG G++K + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            +GGPI  +  +I  ++ + L   YS+I+GDIL   +ESI   + +    +GG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  FHTKGDAVVPEENIKYANEQNTALFK 145
            +HTKGD VV EE       +N   F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 124. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 74.6 bits 319,  Expect = 1e-15
 Identities = 58/152 38%, Positives = 89/152 58%, Gaps = 3/152 1%
Query  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
            MGV T   E+TS+V   K++   + D D++ PK      KSVEI +G+GGPGT+K +T+ 
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
Query  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
            + G    +  +++ +++    ++YSV+ G  L    E I     LV   +GGSI K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154
            +HTKGDA   EE +K    +   LF+A+E Y++AN
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 44.1 bits 170,  Expect = 1e-06
 Identities = 28/75 37%, Positives = 41/75 54%, Gaps = 0/75 0%
Query  77   EALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYA 136
            E   + Y  ++GD L   +E I+    LV      +I KTT+ +HTKGD  + EE++K  
Sbjct  18   EGSQYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAG 77
Query  137  NEQNTALFKALEAYL 151
             E+   LFK +E YL
Sbjct  78   KEKAAHLFKLIEGYL 92

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 34.9 bits 124,  Expect = 0.0004
 Identities = 20/49 40%, Positives = 32/49 65%, Gaps = 1/49 2%
Query  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGP 50
            GV TH  + TS ++  ++F+ + +D D ++ K  P A KS EI +G+GGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 32.0 bits 112,  Expect = 0.009
 Identities = 36/136 26%, Positives = 61/136 44%, Gaps = 6/136 4%
Query  13   SVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIIT-LPDGGPITTMTLR 70
            SV  E ++  +  D  TV+PK  P   K V+ I+GDGG GT+ I   LP+  P +     
Sbjct  12   SVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP-SYQREE 70
Query  71   IDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPE 130
            I   ++ +      VI+G  L   +   +    L    +  ++      +    D  + E
Sbjct  71   ITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSD--IEE 128
Query  131  ENIKYANEQNTALF-KALEAYL 151
            +       Q+T ++ + LE YL
Sbjct  129  KVTPTKTSQSTLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.