The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG
EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY
QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN
Sequence Info Allergen Name Length Opt Bits Score E Value
QOL10866 Que ac 1.0101 159 1014 227.4 1.5e-61
QGS84240 Que i 1.0101 159 866 195.5 5.9e-52
ABZ81045 Que a 1.0201 159 858 193.7 2e-51
ABZ81047 Que a 1.0401 160 763 173.2 2.9e-45
ABZ81046 Que a 1.0301 160 762 173.0 3.4e-45
AUH28179 Que m 1.0101 160 751 170.6 1.8e-44
APD76154 Jug r 5.0101 160 691 157.7 1.4e-40
CAD10374 Cas s 1 160 687 156.8 2.5e-40
O50001 Pru ar 1 160 675 154.3 1.5e-39
ACJ23864 Fag s 1.0101 160 667 152.5 5e-39
CAA96549 Cor a 1.0301 160 664 151.9 7.9e-39
O24248 Pru av 1 160 659 150.8 1.7e-38
Q2I6V8 Pru p 1.0101 160 658 150.6 1.9e-38
CAA96535 Mal d 1.0401 160 646 148.0 1.2e-37
CAA54696.1 Bet v 1.0301 160 646 148.0 1.2e-37
CAA96537 Mal d 1.0403 160 644 147.6 1.6e-37
CAA96536 Mal d 1.0402 160 634 145.4 7e-37
P43186 Bet v 1.0204 160 633 145.2 8.1e-37
CAA04828.1 Bet v 1.0206 159 625 143.5 2.7e-36
B6CQS9 Pru du 1.0101 160 623 143.0 3.6e-36
Q39427 Bet v 1.0205 160 623 143.0 3.6e-36
AAD26546 Mal d 1.0103 159 620 142.4 5.6e-36
P43184 Bet v 1.0203 160 620 142.4 5.7e-36
AAB01362 Mal d 1.0201 159 619 142.2 6.6e-36
AAD26554 Mal d 1.0106 159 619 142.2 6.6e-36
AAD26545 Mal d 1.0202 159 619 142.2 6.6e-36
AAO25113 Mal d 1.0304 159 618 142.0 7.6e-36
AAD29671 Mal d 1.0108 159 618 142.0 7.6e-36
AAD26552 Mal d 1.0104 159 617 141.7 8.8e-36
AAD26558 Mal d 1.0205 159 617 141.7 8.8e-36
CAA88833 Mal d 1.0102 159 617 141.7 8.8e-36
CAA54421 Bet v 1.0201 160 617 141.7 8.9e-36
CAA54481 Bet v 1.0202 160 617 141.7 8.9e-36
AAD26548 Mal d 1.0204 159 615 141.3 1.2e-35
AAD26555 Mal d 1.0107 159 614 141.1 1.4e-35
AAD13683 Mal d 1.0206 159 614 141.1 1.4e-35
CAA58646 Mal d 1.0101 159 613 140.9 1.6e-35
AAD26547 Mal d 1.0203 159 613 140.9 1.6e-35
AAK13030 Mal d 1.0207 159 613 140.9 1.6e-35
CAB02160 Bet v 1.0113 160 613 140.9 1.6e-35
O65200 Pyr c 1 159 611 140.4 2.2e-35
CAA07329.1 Bet v 1.0118 160 611 140.4 2.2e-35
Q256S7 Fra a 1 160 610 140.2 2.5e-35
Q3T923 Fra a 1 160 610 140.2 2.5e-35
CAA96534 Mal d 1.0301 159 609 140.0 2.9e-35
CAA96548 Cor a 1.0201 160 609 140.0 2.9e-35
AAB24432 Aln g 1 160 608 139.8 3.4e-35
CAB02159 Bet v 1.0112 160 608 139.8 3.4e-35
CAA33887 Bet v 1.0101 160 608 139.8 3.4e-35
AAD26553 Mal d 1.0105 159 607 139.6 3.9e-35
CAB02156 Bet v 1.0109 160 607 139.6 4e-35
CAD32318 Mal d 1.0208 158 606 139.4 4.5e-35
CAB02157 Bet v 1.0110 160 605 139.1 5.4e-35
CAA54487 Bet v 1.0106 160 604 138.9 6.2e-35
CAA54483 Bet v 1.0103 160 603 138.7 7.2e-35
AAK13029 Mal d 1.0109 159 602 138.5 8.3e-35
CAA07323.1 Bet v 1.0117 160 602 138.5 8.4e-35
P38948 Aln g 1 159 601 138.3 9.7e-35
CAA54485 Bet v 1.0105 160 601 138.3 9.8e-35
CAB02155 Bet v 1.0108 160 601 138.3 9.8e-35
Q256S6 Fra a 1 160 601 138.3 9.8e-35
CAA04827.1 Bet v 1.0116 159 600 138.1 1.1e-34
AAG40329 Cor a 1.0402 161 600 138.1 1.1e-34
AAK13027 Mal d 1.0302 159 599 137.9 1.3e-34
CAA54484 Bet v 1.0104 160 599 137.9 1.3e-34
CAA54482 Bet v 1.0102 160 598 137.6 1.5e-34
CAB02161 Bet v 1.0114 160 597 137.4 1.8e-34
AAD48405 Cor a 1.0401 161 597 137.4 1.8e-34
AAG40330 Cor a 1.0403 161 597 137.4 1.8e-34
CAB02217 Car b 1.0302 161 595 137.0 2.4e-34
Q256S2 Fra a 1 160 594 136.8 2.8e-34
CAA54489 Bet v 1.0107 160 594 136.8 2.8e-34
CAA96547 Bet v 1.0115 160 594 136.8 2.8e-34
AAG40331 Cor a 1.0404 161 594 136.8 2.8e-34
CAB02158 Bet v 1.0111 160 593 136.6 3.2e-34
Q256S4 Fra a 1 159 591 136.1 4.3e-34
AAK13028 Mal d 1.0303 159 585 134.8 1.1e-33
CAB02216 Car b 1.0301 161 585 134.8 1.1e-33
ACF75030.1 Bet v 1.0207 150 572 132.1 6.9e-33
CAA50325 Cor a 1.0103 160 569 131.4 1.2e-32
AFN42528 Can s 5.0101 161 562 129.9 3.4e-32
CAA50328 Cor a 1.0102 160 559 129.2 5.2e-32
CAA50327 Cor a 1.0101 160 557 128.8 7e-32
P38950 Car b 1 159 552 127.7 1.5e-31
Q08407 Cor a 1 159 550 127.3 2e-31
CAB02207 Car b 1.0104 160 544 126.0 4.9e-31
CAB02206 Car b 1.0103 160 544 126.0 4.9e-31
ABC41615.1 Bet v 1.0119 150 541 125.4 7.1e-31
CAB02208 Car b 1.0105 160 541 125.3 7.7e-31
ABZ81040 Car b 1.0109 160 536 124.3 1.6e-30
CAM31908 Act c 8.0101 159 534 123.8 2.2e-30
ABZ81042 Car b 1.0111 160 534 123.8 2.2e-30
ABZ81043 Car b 1.0112 160 534 123.8 2.2e-30
CAA50326 Cor a 1.0104 160 533 123.6 2.5e-30
ABZ81041 Car b 1.0110 160 533 123.6 2.5e-30
ADK39021 Ost c 1.0101 160 531 123.2 3.4e-30
CAB02209 Car b 1.0106 160 531 123.2 3.4e-30
CAB02213 Car b 1.0107 160 530 123.0 4e-30
ABZ81044 Car b 1.0113 160 530 123.0 4e-30
CAA47357 Car b 1.0102 159 525 121.9 8.4e-30
CAB02215 Car b 1.0108 160 520 120.8 1.8e-29
CAM31909 Act d 8.0101 157 517 120.2 2.7e-29
P38949 Car b 1 159 512 119.1 5.8e-29
Q0Z8U9 Rub i 1.0101 137 494 115.3 7.1e-28
CAA42646 Gly m 4 158 490 114.3 1.6e-27
NP_001275580 Sola l 4.0201 160 483 112.8 4.5e-27
CAA43637 Pha v 1 156 467 109.4 4.8e-26
AAQ91847 Ara h 8.0101 157 465 108.9 6.5e-26
P25985 Pha v 1 155 460 107.9 1.3e-25
AHC08073 Sola l 4.0101 160 459 107.6 1.6e-25
CAA43636 Pha v 1 155 455 106.8 2.8e-25
Q2VU97 Vig r 1.0101 155 434 102.3 6.6e-24
CAA67246 Pet c PR10 155 428 101.0 1.6e-23
EF436550 Ara h 8.0201 153 416 98.4 9.6e-23
P92918 Api g 1.0201 159 396 94.1 2e-21
CAA75803 Lyc e 4.0101 178 393 93.4 3.6e-21
AAL76932 Dau c 1.0201 154 388 92.3 6.3e-21
AAB92255 Tar o RAP 157 373 89.1 6.1e-20
P49372 Api g 1 154 370 88.5 9.4e-20
CAB03716 Dau c 1.0104 154 345 83.1 3.9e-18
CAB06416 Dau c 1.0105 154 342 82.4 6.2e-18
BAA13604 Dau c 1.0102 154 341 82.2 7.2e-18
AAB01092 Dau c 1.0101 168 339 81.7 1.1e-17
CAB03715 Dau c 1.0103 154 334 80.7 2e-17
P85126 Que a 1.0101 50 266 66.5 1.3e-13
Q5ULZ4 Fra a 1.0101 100 238 60.2 2e-11
Q9ZWP8 Vig r 6.0101 155 153 41.6 1.2e-05
Q9S8Q4 Cas s 1 24 137 38.9 1.2e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 227.4 bits 1014,  Expect = 1e-61
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
            EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN
Sbjct  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 2. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 195.5 bits 866,  Expect = 6e-52
 Identities = 134/158 84%, Positives = 144/158 91%, Gaps = 0/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  +ESQETSVIPPARLFKAFVLDSDNLI KVLP+A+KS E IEGNGGPGTIKK TFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
            EASK KY+KHRID LDPENC+YSFSVIEG+ALTD+ S+STE+KFVASPDGGSI KSTTKY
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            QTKG FQLKEEQIQA +EK TGL KAVEAYLLAHPDLY
Sbjct  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 3. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 193.7 bits 858,  Expect = 2e-51
 Identities = 132/158 83%, Positives = 145/158 91%, Gaps = 0/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +ESQETSVI PARLFKA+ LDSDNLI KVLP+A+KSTEIIEGNGGPGTIKK TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
            EASK KYAKHRID LDPENC+YSFSVIEG+ALT + S+STE+K VASPDGGSIMKSTTKY
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            QTKG FQLKEEQIQAA+EK  GL+KAVEAYL+AHPDLY
Sbjct  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 4. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 173.2 bits 763,  Expect = 3e-45
 Identities = 118/158 74%, Positives = 137/158 86%, Gaps = 1/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +ESQETSVI PARLFKA+ LDSDNLI KVLP+A+KSTEIIEGNGGPGTIKK TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +K+AKHRID +DPEN +YSFSVIEG+AL D + ++STE K VASPDGGSI KST+K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            YQTKG FQL +E I+   EK +G+FKAVEAYL+AHPDLY
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 5. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 173.0 bits 762,  Expect = 3e-45
 Identities = 117/158 74%, Positives = 138/158 87%, Gaps = 1/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES++ SVIPPARLFKAFVLDSDNLI KV+P+A+KSTEIIEGNGGPGTIKK TFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +K+AKHRID +DPEN +YSFSVIEG+AL D + ++STE K VASPDGGSI+KST+K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            YQTKG FQL +E I+   EK + +FKAVEAYL+AHPDLY
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 6. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 170.6 bits 751,  Expect = 2e-44
 Identities = 116/158 73%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  YES++ SVIPPARLFKAFVLDSDNLI KV+P+A+KSTEIIEGNGGPGTIKK TFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +K+AKHRID +DPEN ++SFSVIEG+AL D + ++STE K VASPDGGSI+KST K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            YQTKG FQL +E I+   EK +G+FKAVEAYL+AHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 7. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 157.7 bits 691,  Expect = 1e-40
 Identities = 105/159 66%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YE++ TSVIPPARLFKAFVLD+DNLI KV+P+AVKS+EIIEGNGGPGTIKK  FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+ KY KHR D +D  N +Y++SVIEG+AL D I  IS E K VAS +GGSI+KS + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y++KG  ++KEE ++   EK +GLFKAVE YLLAHPD YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 8. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 156.8 bits 687,  Expect = 3e-40
 Identities = 104/159 65%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +E++ TS IPP RLFKAFVLD+DNLI K+ PHA+KS EIIEGNGGPGTIKK TFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDI-ASISTEVKFVASPDGGSIMKSTTK 119
            E S+ KY KHRID +D  N +Y +SVIEG+ + ++   IS E+K VASPDGGSI+K+T+K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE++ A  EK  GLFKAVEAYLLAH D YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 154.3 bits 675,  Expect = 2e-39
 Identities = 101/159 63%, Positives = 132/159 83%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YE++ TSVIPP +LFKAF+LD+DNLI KV P AVK TEI+EG+GG GTIKK TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHR+D +D +N SYS+++IEG+AL+D I +I+ ++K+VASPDGGSI+K+T+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEEQ++A  EK  GLFK VEAYLLA+PD YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 10. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 152.5 bits 667,  Expect = 5e-39
 Identities = 100/159 62%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES+ T+VI PARLFKAFVLD+DNLI KV P+A+KS+EIIEG+GGPGTIKK TFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID +D  N +Y+ ++IEG+A+++ +  I+ E+K+VASPDGGSI+KST+K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KE+QI+A  E+ +G+FKAVEAYLLA+P  Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 11. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 151.9 bits 664,  Expect = 8e-39
 Identities = 103/159 64%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIPPARLFK FVLDSDNLI KV P A+KS EIIEGNGGPGTIKK  F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y K++++ +D  N SY +SVIEG+AL+D +  I+ E+K VASP GGSI+KS +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+T G  +LK+EQI+A  EK +GLFKAVE YLLAH D YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 150.8 bits 659,  Expect = 2e-38
 Identities = 97/159 61%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES+ TS IPP RLFKAFVLD+DNL+ K+ P+A+K +EI+EG+GGPGTIKK TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D EN SYS+++IEG+AL D +  IS E K+VASP GGSI+KST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HPD YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 13. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 150.6 bits 658,  Expect = 2e-38
 Identities = 97/159 61%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES+ TS IPP RLFKAFVLD+DNL+ K+ P+A+K +EI+EG+GGPGTIKK TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D EN SYS+++IEG+AL D +  IS E K+VASP GGSI+KST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HPD YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 14. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 148.0 bits 646,  Expect = 1e-37
 Identities = 95/159 59%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP  RLFKAF+LD DNLI K+ P+A+KSTEIIEG+GG GTIKK TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y K+R++ +D +N +YS+S+IEG+ L+D +  I+ E K++ASPDGGSI+K+T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+ KG  ++KEE+++A  EK +GLFK +EAYLLAH D YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 148.0 bits 646,  Expect = 1e-37
 Identities = 101/159 63%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE + TSVI PARLFK+FVLD+DNLI KV P  V S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY KHR+D +D  N  Y +S+IEG  L D +  IS E+K VA+P GGSI+K T+K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG   L EE+I+A  EKG GLFKAVE YL+AHP+ YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 16. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 147.6 bits 644,  Expect = 2e-37
 Identities = 95/159 59%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP  RLFKAF+LD DNLI K+ P+A+KSTEIIEG+GG GTIKK TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y K+R++ +D +N +YS+S+IEG+ L+D +  I+ E K++ASPDGGSI+K+T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+ KG  ++KEE+++A  EK +GLFK +EAYLLAH D YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 145.4 bits 634,  Expect = 7e-37
 Identities = 93/159 58%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP  RLFKAF+LD DNLI K+ P+A+KST+IIEG+GG GTIKK TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y K+R++ +D +N +YS+S+IEG+ L+D +  I+ E K++ASPDGGSI+K+ + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+ KG  ++KEE+++A  EK +GLFK +EAYLLAH D YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 145.2 bits 633,  Expect = 8e-37
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYES+ TSVIP ARLFKAF+LD DNLI KV P+A+ S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 143.5 bits 625,  Expect = 3e-36
 Identities = 97/158 61%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYES+ TSVIP ARLFKAF+LD DNLI KV P+A+ S E IEGNGGPGTIKK TF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
             S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K+VA+PDGGSI+K + KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            +TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 20. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 143.0 bits 623,  Expect = 4e-36
 Identities = 91/159 57%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG++ Y  + TSVIPP RLFKA+VL++D LI K+ P++VKS EI+EG+GG GTIKK +FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+ID LD +N  Y++S++EG+AL+D +  IS E+K+VAS DGGS++KST+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE ++A  EK TGLFK +E YL+A+PD YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 21. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 143.0 bits 623,  Expect = 4e-36
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNLI KV P+A+ S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K+VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K E+++A  EK   L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 142.4 bits 620,  Expect = 6e-36
 Identities = 95/158 60%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 23. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 142.4 bits 620,  Expect = 6e-36
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYES+ TSVIP ARLFKAF+L+ D LI KV P+A+ S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 142.2 bits 619,  Expect = 7e-36
 Identities = 94/158 59%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 142.2 bits 619,  Expect = 7e-36
 Identities = 95/158 60%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I +IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 26. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 142.2 bits 619,  Expect = 7e-36
 Identities = 94/158 59%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 27. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 142.0 bits 618,  Expect = 8e-36
 Identities = 97/158 61%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES+ TSVIPPARLF AFVLD+DNLI K+ P+AVKS EI+EG+GG GTIKK  FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KHRID +D EN  Y +SVIEG+A+++ I  IS E K+VAS   GS++KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YLL HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 142.0 bits 618,  Expect = 8e-36
 Identities = 95/158 60%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 141.7 bits 617,  Expect = 9e-36
 Identities = 95/158 60%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 141.7 bits 617,  Expect = 9e-36
 Identities = 94/158 59%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE++ A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 31. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 141.7 bits 617,  Expect = 9e-36
 Identities = 94/158 59%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA   G +I KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+ KG  ++KEE+++   EKG GLFK +E+YL  HPD YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 32. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 141.7 bits 617,  Expect = 9e-36
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+L+ D LI KV P+A+ S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 141.7 bits 617,  Expect = 9e-36
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYES+ TSVIP ARLFKAF+L+ D LI KV P+A+ S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 141.3 bits 615,  Expect = 1e-35
 Identities = 93/158 58%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K++AS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 35. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 141.1 bits 614,  Expect = 1e-35
 Identities = 94/158 59%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A   K  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 36. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 141.1 bits 614,  Expect = 1e-35
 Identities = 93/158 58%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFK FVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 37. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 140.9 bits 613,  Expect = 2e-35
 Identities = 94/158 59%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++   EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 38. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 140.9 bits 613,  Expect = 2e-35
 Identities = 93/158 58%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E++L  HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 39. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 140.9 bits 613,  Expect = 2e-35
 Identities = 93/158 58%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGT KK TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 40. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 140.9 bits 613,  Expect = 2e-35
 Identities = 93/159 58%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL+ KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 140.4 bits 611,  Expect = 2e-35
 Identities = 93/158 58%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG+Y +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHR+D++D  + SY++++IEG+ALTD I  IS E K+VAS   GS +KS + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 42. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 140.4 bits 611,  Expect = 2e-35
 Identities = 93/159 58%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNLI KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K+VA+PDGGSI++ + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 140.2 bits 610,  Expect = 3e-35
 Identities = 91/159 57%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY YE++ TS IP  +LFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+I ++D EN +YS+S+IEG+AL+D I  I  E K+V++P GG+I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 44. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 140.2 bits 610,  Expect = 3e-35
 Identities = 91/159 57%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY YE++ TS IP  +LFKAFVLD+DNLI K+ P+AVK  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+I ++D EN +YS+S+IEG+AL+D I  I  E K+V++P GG+++K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 45. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 140.0 bits 609,  Expect = 3e-35
 Identities = 96/158 60%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIPPARLF AFVLD+DNLI K+ P+AVKS EI+EG+GG GTIKK  FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KHRID +D EN  Y +SVIEG+A+++ I  IS E K+VAS   GS++KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TK   ++KEE+++A  EK + LFK +E YLLAH D YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 46. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 140.0 bits 609,  Expect = 3e-35
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD +NLI KV P+AV S E +EGNGGPGTIKK TF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R++ +D  N  YS++VIEG  + D +  I  E+K VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++  E+I+   EK  GLF+AVEAYLLAH D YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 139.8 bits 608,  Expect = 3e-35
 Identities = 95/159 59%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFKAF+LD D L+ KV P AV S E IEGNGGPGTIKK TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  KY K R+D +D  N  YSFSVIEG A+ D +  +  E+K VA+PDGGSI+K + K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++TKG  ++  EQI+   EK  GL+KAVE+YLLAH D YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 139.8 bits 608,  Expect = 3e-35
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGGSI+K + K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 139.8 bits 608,  Expect = 3e-35
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 139.6 bits 607,  Expect = 4e-35
 Identities = 94/158 59%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 139.6 bits 607,  Expect = 4e-35
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 139.4 bits 606,  Expect = 5e-35
 Identities = 93/157 59%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GVY YE++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
             S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            +TKG  ++ EE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 53. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 139.1 bits 605,  Expect = 5e-35
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDI-ASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + DI   IS E+K VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 138.9 bits 604,  Expect = 6e-35
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  YS+SVIEG  + D +  IS E+K VA+P+GGSI+K   K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQI+A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 138.7 bits 603,  Expect = 7e-35
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  YS+SVIEG  + D +  IS E+K VA+P+GGSI+K   K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQI+A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 138.5 bits 602,  Expect = 8e-35
 Identities = 93/158 58%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA    GS +KS + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++   EK  GLFK +E+YL  HPD YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 57. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 138.5 bits 602,  Expect = 8e-35
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 138.3 bits 601,  Expect = 1e-34
 Identities = 94/158 59%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYE++  SVIP ARLFKAF+LD D L+ KV P AV S E IEGNGGPGTIKK TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
             S  KY K R+D +D  N  YSFSVIEG A+ D +  +  E+K VA+PDGGSI+K + K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            +TKG  ++  EQI+   EK  GL+KAVE+YLLAH D YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 59. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 138.3 bits 601,  Expect = 1e-34
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYES+ TSVIP ARLFKAF+L+ DNLI KV P+A+ S E IEGNGGPGTIKK  F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 138.3 bits 601,  Expect = 1e-34
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 138.3 bits 601,  Expect = 1e-34
 Identities = 90/159 56%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG Y YE++ TS IP  +LFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+I ++D EN +YS+S+IEG+AL+D I  I  E K+V++P GG+I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 138.1 bits 600,  Expect = 1e-34
 Identities = 92/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
                KY K R+D +D  N  YS+S+IEG  + D +  IS E+K VA+PDGGSI+K + KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            +TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 63. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 138.1 bits 600,  Expect = 1e-34
 Identities = 94/158 59%, Positives = 117/158 74%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV++YE + TSVIPPARLFK+FVLD+DNLI KV P+     E +EGNGGPGTIKK TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGG-SIMKSTT 118
            E S+ KY KH+++ +D  N  Y +S+IEG  L   +  IS E+K  A+P GG SI+K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            KY+TKG   + EE+I+A  EK  GLFKAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 64. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 137.9 bits 599,  Expect = 1e-34
 Identities = 94/158 59%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES+ TSVIPPARLF AFVLD+DNLI K+ P+AVKS EI+EG+GG GTIKK  FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KHRID +D +N  Y +SVIEG+A+++ I  IS E K+VA+   GS++KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YLL H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 137.9 bits 599,  Expect = 1e-34
 Identities = 94/159 59%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE + TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  YS+SVIEG  + D +  IS E+K VA+P+GGSI+K   K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQI+A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 137.6 bits 598,  Expect = 2e-34
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE + TSVIP ARLFKAF+LD DNL+ KV P+A+ S E IEGNGGPGTIKK  F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 137.4 bits 597,  Expect = 2e-34
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGGSI+K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E    L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 137.4 bits 597,  Expect = 2e-34
 Identities = 94/158 59%, Positives = 117/158 74%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YE + TSVIPPARLFK+FVLD+DNLI KV P+   S E +EGNGGPGTIKK TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGG-SIMKSTT 118
            E ++ KY KH+++ +D  N  Y +S+IEG  L   +  IS E+K  A+P GG SI+K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            KY+TKG   + EE+I+A  EK  GLFKAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 69. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 137.4 bits 597,  Expect = 2e-34
 Identities = 94/158 59%, Positives = 116/158 73%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YE + TSVIPPARLFK+FVLD+DNLI KV P+     E +EGNGGPGTIKK TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGG-SIMKSTT 118
            E S+ KY KH+++ +D  N  Y +S+IEG  L   +  IS E+K  A+P GG SI+K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            KY+TKG   + EE+I+A  EK  GLFKAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 70. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 137.0 bits 595,  Expect = 2e-34
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD +NLI KV P+AV S E +EGNGGPGTIKK TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S VKY K R++ +D  N  YS++VIEG  + D +  I  E+K VA+PDGGSI+K T+K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++  E+I+   E+  GL+K VEAYLLAH   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 71. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 136.8 bits 594,  Expect = 3e-34
 Identities = 90/159 56%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY YE++ TS IP  +LFKAFVLD+DNLI K+ P+AVK  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+I ++D  N +YS+S+IEG+AL++ I  I  E K+V++P GG+I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK   LFK +E YL  HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 136.8 bits 594,  Expect = 3e-34
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP AR+FKAF+LD D L+ KV P+A+ S E IEGNGGPGTIKK  F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 136.8 bits 594,  Expect = 3e-34
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    KY K R+D +  +N  YS+SVIEG  + D +  IS E+K VA+PDG SI+K + K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQI+A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 136.8 bits 594,  Expect = 3e-34
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV++YE + TSVIPPARLFK+FVLD+DNLI KV P+   S E +EGNGGPGTIKK TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGG-SIMKSTT 118
            E ++ KY KH+++ +D  N  Y +S+IEG  L   +  I  E+K  A+P GG SI+K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            KY+TKG   + EE+I+A  EK  GLFKAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 75. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 136.6 bits 593,  Expect = 3e-34
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
                 KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 136.1 bits 591,  Expect = 4e-34
 Identities = 91/158 57%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGVY YE++ TS IP  +LFKAFVLD+DNLI K+ P+AVK  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+I ++D EN +YS+S+IEG+AL+D I  I  E K+V++P G +I+K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 77. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 134.8 bits 585,  Expect = 1e-33
 Identities = 92/158 58%, Positives = 120/158 75%, Gaps = 2/158 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YE + TSVIPPARL+ AFVLD+DNLI K+ P+AVKSTEI+EG+GG GTIKK  FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S   Y KH+ID +D +N  Y +SVIEG+A+++ I  IS E K+VAS   GS++KS + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YLL H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 78. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 134.8 bits 585,  Expect = 1e-33
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFKAF+LD + LI KV P+AV S E +EGNGGPGTIKK TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S VKY K R++ +D  N  YS++VIEG  + D +  I  E+K VA+PDGGSI+K T+K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  ++  E+I+   E+  GL+K VEAYLLAH   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 79. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 132.1 bits 572,  Expect = 7e-33
 Identities = 89/149 59%, Positives = 113/149 75%, Gaps = 1/149 0%
Query  4    YNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGEAS 63
            +NYES+ TSVIP ARLFKAF+L+ DNLI KV P+A+ S E IEGNGGPGTIKK TF E S
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   KVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKYQT 122
              KY K R+D +D  N  YS+S+IEG AL D +  I  E+K VA+PDGGSI+K + KY+T
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGGFQLKEEQIQAAVEKGTGLFKAVEAYLL 152
            KG  ++K E+++A  EKG  L++AVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 80. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 131.4 bits 569,  Expect = 1e-32
 Identities = 86/159 54%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++ TSVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+ KY K R+D +D  N +YS++VIEG+ L D +  +  E+K VA+P GGSI+K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+I+ A E    L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 81. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 129.9 bits 562,  Expect = 3e-32
 Identities = 84/159 52%, Positives = 118/159 74%, Gaps = 2/159 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ YES+ TS I PARLFKAFVLD DNL+ K+ P+AV+  EI+EGNGG GTIKK TFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEAL--TDIASISTEVKFVASPDGGSIMKSTT 118
            +    KY KH+I+ +D E+ +YS+S+IEG+AL    +  I+ E K+VAS DGG+++K+ +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            KY + G  Q+ EE+++   ++ T ++K VEAYL  HP+ YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 82. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 129.2 bits 559,  Expect = 5e-32
 Identities = 84/159 52%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE +  SVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+ KY K R+D +D  N  YS++VIEG+ L D +  + +E+K VA+P GGSI+K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 83. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 128.8 bits 557,  Expect = 7e-32
 Identities = 84/159 52%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE +  SVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+ KY K R+D +D  N +YS++VIEG+ L D +  +  E+K VA+P GGSI+K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 127.7 bits 552,  Expect = 1e-31
 Identities = 85/158 53%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYE++ TSVIP ARLFKAF+LD + LI KV P+AV S E +EGNGGPGTIKK TF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
             S VKY K R++ +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            + KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 85. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 127.3 bits 550,  Expect = 2e-31
 Identities = 83/158 52%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYE +  SVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
             S+ KY K R+D +D  N +YS++VIEG+ L D +  +  E+K VA+P GGSI+K ++K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            + KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 86. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 126.0 bits 544,  Expect = 5e-31
 Identities = 82/159 51%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 87. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 126.0 bits 544,  Expect = 5e-31
 Identities = 82/159 51%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 88. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 125.4 bits 541,  Expect = 7e-31
 Identities = 83/149 55%, Positives = 109/149 73%, Gaps = 1/149 0%
Query  4    YNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGEAS 63
            +NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S + IEGNGGPGTIKK  F E  
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   KVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKYQT 122
              KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG I+K + KY+T
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGGFQLKEEQIQAAVEKGTGLFKAVEAYLL 152
            KG  ++K EQ++A+ E G  L++AVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 89. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 125.3 bits 541,  Expect = 8e-31
 Identities = 82/159 51%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 124.3 bits 536,  Expect = 2e-30
 Identities = 81/159 50%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 123.8 bits 534,  Expect = 2e-30
 Identities = 80/156 51%, Positives = 112/156 71%, Gaps = 1/156 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  Y+ +  S +PP +L+KAF+LD D L+ KVLPHA+K  +I+EG+G  GTIK+ TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K  K+R+D +D +N +YS+++IEG+ L +   SIS  +K VA PDGGSI K+ + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPD 156
            Y TKG  ++ EE+I+   EK   +FKA+EAYLLA+PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 92. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 123.8 bits 534,  Expect = 2e-30
 Identities = 81/159 50%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 123.8 bits 534,  Expect = 2e-30
 Identities = 81/159 50%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 123.6 bits 533,  Expect = 3e-30
 Identities = 81/159 50%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE +  SVI  ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S+ KY K R+D +D  N  YS++VIEG+ L D +  + +E+K VA+P GGS +K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 123.6 bits 533,  Expect = 3e-30
 Identities = 80/159 50%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGS++K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 123.2 bits 531,  Expect = 3e-30
 Identities = 80/159 50%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+   E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 97. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 123.2 bits 531,  Expect = 3e-30
 Identities = 81/159 50%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 98. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 123.0 bits 530,  Expect = 4e-30
 Identities = 81/159 50%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  +S++VIEG+ L D +  +S E+K VA+P GGSI+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 99. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 123.0 bits 530,  Expect = 4e-30
 Identities = 81/159 50%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E    K+ K R+D +D  N  YS++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 121.9 bits 525,  Expect = 8e-30
 Identities = 80/158 50%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
             S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            + KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 120.8 bits 520,  Expect = 2e-29
 Identities = 79/159 49%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+NYE++  SV+P ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S  K+ K R+D +D  N  +S++VIEG+ L D +  +S E+  VA+P GGSI+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 120.2 bits 517,  Expect = 3e-29
 Identities = 82/156 52%, Positives = 105/156 67%, Gaps = 0/156 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG   Y+ +  S I   ++FKAFVLD D +I K LPHA+   + +EG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
            E S  K  KHRID LD EN +YS+S+IEG AL    SIS  +K VA+PDGG I K+ + Y
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPD 156
              K   Q+ EE+I+A  E+ +G+FK VEAYLLA+PD
Sbjct  121  TPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 103. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 119.1 bits 512,  Expect = 6e-29
 Identities = 78/158 49%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+NYE++  SVIP ARLFK++VLD D LI KV P+ + S E + GNGGPGTIK  TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
                K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            + KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 115.3 bits 494,  Expect = 7e-28
 Identities = 79/134 58%, Positives = 103/134 76%, Gaps = 2/134 1%
Query  11   TSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGEASKVKYAKH 70
            TSVIPP +LFKAFVLD+DNLI K+ P+AVKS EIIEG+GG GT+KK  +GE ++  Y KH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKYQTKGGFQLK 129
            +ID LD  N  YS+S+ EG+AL D I  IS E+K+VAS   GSI+K+T+ Y+ KGG ++K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEQIQAAVEKGTGLFK 145
            EEQ++   E+  GLFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 114.3 bits 490,  Expect = 2e-27
 Identities = 79/157 50%, Positives = 109/157 69%, Gaps = 3/157 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +E +  S + PA L+KA+V D+DN+I K L  + KS E +EGNGGPGTIKK TF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD-SFKSVENVEGNGGPGTIKKITFL 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
            E  + K+  H+I+++D  N  YS+SV+ G AL D A  I+ + K+VA P+GGS  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159
            Y+TKG  +  +++++    K   LFKA+EAYLLAHPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 112.8 bits 483,  Expect = 5e-27
 Identities = 76/158 48%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  +  + T+ I P RLFK +VLD D+L+ K+L H VKS EI+EG+GG G+IK+  F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E   +KY KH+I  +D +N    +S+IEG+ L D + SI+ +VKF A+ DGG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            Y+TKG   + EE+      K   LFKA+EAYLLA+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 109.4 bits 467,  Expect = 5e-26
 Identities = 71/155 45%, Positives = 104/155 67%, Gaps = 1/155 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +E Q TS + PA L+KA   D+D +  K LP + KS EI+EGNGGPGTIKK +F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
            E  + K+  H+I+++D  N  YS+S++ G AL + A  I+ + K+   P+GGS++K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155
            Y++KG     E++++A   K   LFKAVEAYLLA+P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 108.9 bits 465,  Expect = 6e-26
 Identities = 73/156 46%, Positives = 110/156 70%, Gaps = 3/156 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +E + TS +PPA+L+ A + D+D++  K++   VKS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
            E  + K+  H+++++D  N +Y++SV+ G AL   A  I+ E K+V  P+GGSI K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            Y+TKG  +  EE+++    KG GLF+A+E Y+LA+P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 107.9 bits 460,  Expect = 1e-25
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
            GV+ +E Q TS + PA L+KA   D+D +  K LP + KS EI+EGNGGPGTIKK +F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTKY 120
              + K+  H+I+++D  N  YS+S++ G AL + A  I+ + K+   P+GGS++K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155
            ++KG     E++++A   K   LFKAVEAYLLA+P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 110. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 107.6 bits 459,  Expect = 2e-25
 Identities = 73/158 46%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  Y  + T+ I P RLFKA+VLD DNL+ K+L + VK+ E IEG+GG G+IK+  F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E   +KY KH+I  +D +N    +S+IEG+ L + + SI+ ++KF A+ +GG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158
            Y+TKG   + EE+     E+   + KAVEAYLLA+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 106.8 bits 455,  Expect = 3e-25
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 2/154 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            M V+ +E Q TS + PA L+KA+V D+D ++ K +  + KS EI+EGNGGPGTIKK +F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
            E  + K+  H+I+ +D  N  YS+S++ G AL D A  IS + K+   P+GGS++K + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155
            Y++KG     E++++A   K   LFK +EAYLLA+P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 102.3 bits 434,  Expect = 7e-24
 Identities = 69/154 44%, Positives = 101/154 65%, Gaps = 2/154 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            M V+ ++ Q TS + PA L+ A+  D+DN+I K +  + +S EI+EGNGGPGTIKK +F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
            E  + K+  H+I+++D  N  YS+S++ G AL D A  I+ + K     DGGS++K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155
            Y+ KG     E++++A   K   LFKAVEAYLLA+P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 101.0 bits 428,  Expect = 2e-23
 Identities = 72/154 46%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV   E   TS +P A+LFKA+ LD D L+ +VLP A+K  EI+EG+GG GT+K  T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            +AS  K  K++ID +D E  ++S+S+I+G+ L   I SI+  + FV + DGG    ST  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            + TKG   + EE I+ A ++   +FKAVEAYLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 98.4 bits 416,  Expect = 1e-22
 Identities = 66/152 43%, Positives = 101/152 66%, Gaps = 3/152 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV+ +E + TS +PPA+LFKA V+D D L  K++P A++S EI+EGNGGPGT+KK T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDI-ASISTEVKFVASPDGGSIMKSTTK 119
            E  K  Y  H+ID +D    +Y +++  G  + +I   +S + K+ A+ DGGS +K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   L +E  Q   +K  G+FKA+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 94.1 bits 396,  Expect = 2e-21
 Identities = 66/152 43%, Positives = 99/152 65%, Gaps = 4/152 2%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV     +  S +   ++++ F+LD D +  KVLP+ +KS EI+EG+GG GT+K   +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDI-ASISTEVKFVASP-DGGSIMKSTT 118
            EA++    K+++D +D    +Y+++ I G+ L D+  S+  E  FV  P DGG I+K+TT
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNE--FVVVPTDGGCIVKNTT 118
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
             Y TKG   L E++I+ A EK    FKAVEAYLLA+
Sbjct  119  IYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 93.4 bits 393,  Expect = 4e-21
 Identities = 61/132 46%, Positives = 91/132 68%, Gaps = 1/132 0%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  Y  + T+ I P RLFKA+VLD DNL+ K+L + VK+ E IEG+GG G+IK+  F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E   +KY KH+I  +D +N    +S+IEG+ L + + SI+ ++KF A+ +GG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YQTKGGFQLKEEQ 132
            Y+TKG   + EE+
Sbjct  121  YHTKGDHVVSEEE 133

Sequence Alignment: 117. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 92.3 bits 388,  Expect = 6e-21
 Identities = 63/152 41%, Positives = 99/152 65%, Gaps = 4/152 2%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV   E +  S +   ++++ F+LD D +  KVLP+ +KS EI+EG+GG GT++   +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASP-DGGSIMKSTT 118
            EA++    K+++D +D     Y+++ I G+ L + + S+    +FV  P DGG I+K+TT
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVN--QFVVVPTDGGCIVKNTT 118
Query  119  KYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
             Y TKG   L E++++ A EK    FKAVEAYLLA+
Sbjct  119  IYNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 89.1 bits 373,  Expect = 6e-20
 Identities = 59/154 38%, Positives = 91/154 59%, Gaps = 3/154 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            M V  +E   TS + P+ +FKAFV+D D +  K  P   KS + IEG+GG GTIK  T+ 
Sbjct  1    MAVAEFEI--TSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTE-VKFVASPDGGSIMKSTTK 119
            +      +KH++D +D  N S S+++ EG+ L  I    T  +KF+ S DGGS+ K +  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPD 156
            ++ KG  +L +E +    E     FKA+E Y+++HP+
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPE 155

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 88.5 bits 370,  Expect = 9e-20
 Identities = 64/153 41%, Positives = 97/153 63%, Gaps = 2/153 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MGV  +  + TS +   ++F+ FV+D D ++ K  P A KS EI +G+GGPGT+K  T+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            +   +     RID ++ E  ++ +SVI+G+ L   I SI   V +V + DGGSI K+T  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   + EE I+ A E+ T LFKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 83.1 bits 345,  Expect = 4e-18
 Identities = 61/153 39%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG  ++  + TS +   ++F   VLD D +I K  P A KS ++ +G+GG GT++  T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +     R D ++ E  +Y  +VI+G+ L   I SI T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   + EE I+ A E+ T LFKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 82.4 bits 342,  Expect = 6e-18
 Identities = 61/153 39%, Positives = 92/153 60%, Gaps = 2/153 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG  ++  + TS +   ++F   VLD D +I K  P A KS E+ +G+GG GT++  T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +     R D ++ E  +Y  +VI+G+ L   I SI T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   + EE I+ A  + T LFKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 82.2 bits 341,  Expect = 7e-18
 Identities = 60/153 39%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG  ++  + TS +   ++F   VLD D +I K  P A KS ++ +G+GG GT++  T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +     R D ++ E  +Y  +VI+G+ L + I SI T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   + EE I+ A  + T LFKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 81.7 bits 339,  Expect = 1e-17
 Identities = 60/153 39%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG  ++  + TS +   ++F   VLD D +I K  P A KS ++ +G+GG GT++  T+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +     R D ++ E  +Y  +VI+G+ L + I SI T +  V + DGGSI K+T  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   + EE I+ A  + T LFKA+EAYL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 80.7 bits 334,  Expect = 2e-17
 Identities = 61/153 39%, Positives = 91/153 59%, Gaps = 2/153 1%
Query  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
            MG  ++  + TS +   ++F   VLD D +I K    A KS E+ +G+GG GT++  T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
            E S +     R D ++ E  SY  +VI+G+ L   I SI T +  V + DGGSI K+T  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154
            ++TKG   + EE I+ A  + T LFKA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 66.5 bits 266,  Expect = 1e-13
 Identities = 41/50 82%, Positives = 46/50 92%, Gaps = 0/50 0%
Query  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGP 51
            GV+ +ESQETSVI PARLFKA+ LDSDNLI KVLP+A+KSTEIIEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 126. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 60.2 bits 238,  Expect = 2e-11
 Identities = 53/99 53%, Positives = 73/99 73%, Gaps = 40/99 40%
Query  22   AFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGEASKVKYAKHRIDTLDPENCS 81
            AFVLD+DNLI    P                  KK TFGE S+  Y K            
Sbjct  1    AFVLDADNLI----P------------------KKITFGEGSQYGYVK------------ 26
Query  82   YSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKYQTKGGFQLKEEQIQAAVEKG 140
                 +EG+AL+D +  I  E K+V++P   +I+K+T+KY+TKG  ++KEE+++A  EK 
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  TGLFKAVEAYLLAHPDLYN 159
              LFK +E YL  HP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 41.6 bits 153,  Expect = 1e-05
 Identities = 37/147 25%, Positives = 66/147 44%, Gaps = 4/147 2%
Query  3    VYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGEA 62
            V  + +Q    +    L+  +  D   ++ KVLPH VK  ++IEG+GG GTI  F F   
Sbjct  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
Query  63   SKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKYQ 121
                Y +  I  +D  +    + VIEG  L   ++   T  K+    +  +++     Y 
Sbjct  62   VSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYD 121
Query  122  TKGGFQLKEEQIQAAVEKGTGLF-KAVEAYL 151
                  ++E+       + T ++ + +E YL
Sbjct  122  HDS--DIEEKVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 38.9 bits 137,  Expect = 1e-05
 Identities = 21/24 87%, Positives = 23/24 95%, Gaps = 0/24 0%
Query  2    GVYNYESQETSVIPPARLFKAFVL 25
            GV+ +ESQETSVIPPARLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.