The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD29671 Mal d 1.0108 159 1030 306.9 1.7e-85
CAA58646 Mal d 1.0101 159 1025 305.4 4.7e-85
AAD26554 Mal d 1.0106 159 1024 305.1 5.8e-85
AAD26546 Mal d 1.0103 159 1021 304.3 1.1e-84
AAD26552 Mal d 1.0104 159 1020 304.0 1.3e-84
AAD26553 Mal d 1.0105 159 1019 303.7 1.6e-84
AAK13029 Mal d 1.0109 159 1014 302.2 4.4e-84
AAD26555 Mal d 1.0107 159 1010 301.0 9.9e-84
CAA88833 Mal d 1.0102 159 1001 298.4 6.1e-83
O65200 Pyr c 1 159 985 293.7 1.6e-81
AAB01362 Mal d 1.0201 159 960 286.4 2.5e-79
AAD26545 Mal d 1.0202 159 960 286.4 2.5e-79
AAD26548 Mal d 1.0204 159 956 285.2 5.7e-79
AAD13683 Mal d 1.0206 159 955 284.9 7e-79
AAK13030 Mal d 1.0207 159 954 284.6 8.5e-79
AAD26547 Mal d 1.0203 159 954 284.6 8.5e-79
AAD26558 Mal d 1.0205 159 952 284.0 1.3e-78
CAD32318 Mal d 1.0208 158 950 283.5 1.9e-78
O24248 Pru av 1 160 885 264.4 1e-72
Q2I6V8 Pru p 1.0101 160 869 259.7 2.7e-71
AAO25113 Mal d 1.0304 159 823 246.3 3e-67
Q256S4 Fra a 1 159 818 244.8 8.3e-67
AAK13027 Mal d 1.0302 159 811 242.8 3.4e-66
Q256S7 Fra a 1 160 811 242.8 3.5e-66
Q3T923 Fra a 1 160 810 242.5 4.2e-66
Q256S2 Fra a 1 160 804 240.7 1.4e-65
Q256S6 Fra a 1 160 802 240.1 2.2e-65
AAK13028 Mal d 1.0303 159 798 239.0 4.8e-65
CAA96534 Mal d 1.0301 159 794 237.8 1.1e-64
APD76154 Jug r 5.0101 160 781 234.0 1.5e-63
O50001 Pru ar 1 160 769 230.5 1.7e-62
CAA96536 Mal d 1.0402 160 753 225.8 4.5e-61
CAA96537 Mal d 1.0403 160 750 224.9 8.2e-61
CAA96535 Mal d 1.0401 160 750 224.9 8.2e-61
CAD10374 Cas s 1 160 736 220.8 1.4e-59
B6CQS9 Pru du 1.0101 160 727 218.2 8.8e-59
ACJ23864 Fag s 1.0101 160 715 214.6 1e-57
CAA96549 Cor a 1.0301 160 688 206.7 2.4e-55
CAA54696.1 Bet v 1.0301 160 680 204.4 1.2e-54
AAG40329 Cor a 1.0402 161 672 202.1 6.2e-54
AAD48405 Cor a 1.0401 161 672 202.1 6.2e-54
AAG40331 Cor a 1.0404 161 669 201.2 1.1e-53
AAG40330 Cor a 1.0403 161 669 201.2 1.1e-53
AFN42528 Can s 5.0101 161 666 200.3 2.1e-53
ABZ81046 Que a 1.0301 160 650 195.6 5.4e-52
Q39427 Bet v 1.0205 160 647 194.7 9.9e-52
AUH28179 Que m 1.0101 160 643 193.6 2.2e-51
P43186 Bet v 1.0204 160 640 192.7 4.1e-51
CAA04828.1 Bet v 1.0206 159 634 190.9 1.4e-50
Q0Z8U9 Rub i 1.0101 137 629 189.6 3e-50
CAA54481 Bet v 1.0202 160 628 189.2 4.7e-50
P43184 Bet v 1.0203 160 627 188.9 5.7e-50
CAA54421 Bet v 1.0201 160 626 188.6 7e-50
CAA96548 Cor a 1.0201 160 624 188.0 1.1e-49
ABZ81047 Que a 1.0401 160 623 187.7 1.3e-49
QOL10866 Que ac 1.0101 159 618 186.3 3.5e-49
CAA07329.1 Bet v 1.0118 160 615 185.4 6.5e-49
QGS84240 Que i 1.0101 159 604 182.2 6e-48
CAB02160 Bet v 1.0113 160 604 182.1 6.1e-48
CAA04827.1 Bet v 1.0116 159 603 181.9 7.4e-48
CAA07323.1 Bet v 1.0117 160 600 181.0 1.4e-47
CAA33887 Bet v 1.0101 160 599 180.7 1.7e-47
CAB02155 Bet v 1.0108 160 599 180.7 1.7e-47
CAB02159 Bet v 1.0112 160 599 180.7 1.7e-47
CAA54482 Bet v 1.0102 160 598 180.4 2.1e-47
CAB02156 Bet v 1.0109 160 598 180.4 2.1e-47
CAA54485 Bet v 1.0105 160 597 180.1 2.5e-47
CAB02161 Bet v 1.0114 160 597 180.1 2.5e-47
CAA54487 Bet v 1.0106 160 597 180.1 2.5e-47
CAA54483 Bet v 1.0103 160 596 179.8 3.1e-47
CAB02157 Bet v 1.0110 160 594 179.2 4.6e-47
CAA54484 Bet v 1.0104 160 594 179.2 4.6e-47
ABZ81045 Que a 1.0201 159 593 178.9 5.6e-47
CAA50325 Cor a 1.0103 160 593 178.9 5.7e-47
CAB02217 Car b 1.0302 161 593 178.9 5.7e-47
CAB02158 Bet v 1.0111 160 591 178.3 8.5e-47
CAA54489 Bet v 1.0107 160 591 178.3 8.5e-47
CAA96547 Bet v 1.0115 160 590 178.0 1e-46
AAB24432 Aln g 1 160 589 177.8 1.3e-46
ACF75030.1 Bet v 1.0207 150 582 175.8 4.8e-46
P38948 Aln g 1 159 582 175.7 5.2e-46
CAA50327 Cor a 1.0101 160 582 175.7 5.3e-46
CAB02216 Car b 1.0301 161 580 175.1 8e-46
CAB02207 Car b 1.0104 160 578 174.5 1.2e-45
CAB02206 Car b 1.0103 160 577 174.2 1.5e-45
CAA50328 Cor a 1.0102 160 576 174.0 1.8e-45
Q08407 Cor a 1 159 575 173.7 2.2e-45
CAB02208 Car b 1.0105 160 574 173.4 2.7e-45
ABZ81041 Car b 1.0110 160 568 171.6 9.1e-45
ADK39021 Ost c 1.0101 160 567 171.3 1.1e-44
ABZ81043 Car b 1.0112 160 567 171.3 1.1e-44
ABZ81042 Car b 1.0111 160 567 171.3 1.1e-44
ABZ81040 Car b 1.0109 160 565 170.7 1.7e-44
CAB02209 Car b 1.0106 160 564 170.4 2e-44
ABZ81044 Car b 1.0113 160 563 170.1 2.5e-44
P38950 Car b 1 159 562 169.9 3e-44
CAA50326 Cor a 1.0104 160 562 169.9 3.1e-44
CAM31908 Act c 8.0101 159 558 168.7 6.8e-44
CAA47357 Car b 1.0102 159 556 168.1 1e-43
CAB02213 Car b 1.0107 160 554 167.5 1.6e-43
CAB02215 Car b 1.0108 160 544 164.6 1.2e-42
P38949 Car b 1 159 543 164.3 1.4e-42
ABC41615.1 Bet v 1.0119 150 542 164.0 1.6e-42
CAA42646 Gly m 4 158 520 157.6 1.5e-40
AAQ91847 Ara h 8.0101 157 499 151.4 1.1e-38
CAM31909 Act d 8.0101 157 498 151.1 1.3e-38
EF436550 Ara h 8.0201 153 494 150.0 2.8e-38
CAA43637 Pha v 1 156 488 148.2 9.8e-38
CAA43636 Pha v 1 155 482 146.5 3.3e-37
P25985 Pha v 1 155 481 146.2 4e-37
NP_001275580 Sola l 4.0201 160 478 145.3 7.8e-37
Q2VU97 Vig r 1.0101 155 461 140.3 2.3e-35
AHC08073 Sola l 4.0101 160 452 137.6 1.5e-34
CAA75803 Lyc e 4.0101 178 420 128.2 1.2e-31
CAA67246 Pet c PR10 155 407 124.5 1.3e-30
P92918 Api g 1.0201 159 395 121.0 1.6e-29
AAB92255 Tar o RAP 157 391 119.8 3.5e-29
AAL76932 Dau c 1.0201 154 389 119.2 5.1e-29
P49372 Api g 1 154 374 114.8 1.1e-27
Q5ULZ4 Fra a 1.0101 100 357 110.2 1.7e-26
CAB03716 Dau c 1.0104 154 343 105.8 5.8e-25
CAB06416 Dau c 1.0105 154 340 104.9 1.1e-24
BAA13604 Dau c 1.0102 154 338 104.3 1.6e-24
AAB01092 Dau c 1.0101 168 336 103.6 2.8e-24
CAB03715 Dau c 1.0103 154 331 102.2 6.6e-24
P85126 Que a 1.0101 50 219 70.4 8.4e-15
Q9ZWP8 Vig r 6.0101 155 163 53.0 4.3e-09
Q9S8Q4 Cas s 1 24 109 38.8 1.3e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 306.9 bits 1030,  Expect = 2e-85
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 2. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 305.4 bits 1025,  Expect = 5e-85
 Identities = 158/159 99%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVK GKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 3. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 305.1 bits 1024,  Expect = 6e-85
 Identities = 158/159 99%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIE ISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 304.3 bits 1021,  Expect = 1e-84
 Identities = 158/159 99%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 5. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 304.0 bits 1020,  Expect = 1e-84
 Identities = 157/159 98%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 6. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 303.7 bits 1019,  Expect = 2e-84
 Identities = 158/159 99%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV TFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 7. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 302.2 bits 1014,  Expect = 4e-84
 Identities = 157/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV TFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVK GKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 8. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 301.0 bits 1010,  Expect = 1e-83
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGK KAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 9. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 298.4 bits 1001,  Expect = 6e-83
 Identities = 154/159 96%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG+TIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KGNIEIKEEHVK GKEK HGLFKLIESYLK HPDAYN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 293.7 bits 985,  Expect = 2e-81
 Identities = 151/159 94%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG+YTFENEFTSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEGNGGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHR+DSIDEASYSY+YTLIEGDALTDTIEKISYE KLVA GSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+IEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 286.4 bits 960,  Expect = 3e-79
 Identities = 145/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 286.4 bits 960,  Expect = 3e-79
 Identities = 145/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 285.2 bits 956,  Expect = 6e-79
 Identities = 144/159 90%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKL+A GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 284.9 bits 955,  Expect = 7e-79
 Identities = 144/159 90%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFK FVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 284.6 bits 954,  Expect = 9e-79
 Identities = 144/159 90%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 284.6 bits 954,  Expect = 9e-79
 Identities = 144/159 90%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIES+LK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 284.0 bits 952,  Expect = 1e-78
 Identities = 144/159 90%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 283.5 bits 950,  Expect = 2e-78
 Identities = 143/158 90%, Positives = 154/158 97%, Gaps = 0/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GVYT+ENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYH 121
            GSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHYH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            TKG++EI EEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 19. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 264.4 bits 885,  Expect = 1e-72
 Identities = 136/159 85%, Positives = 149/159 93%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
            EGSQYGYVKH+IDSID+ +YSYSYTLIEGDAL DT+EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN+EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 20. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 259.7 bits 869,  Expect = 3e-71
 Identities = 133/159 83%, Positives = 148/159 93%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+EFTSEIPP RLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 21. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 246.3 bits 823,  Expect = 3e-67
 Identities = 123/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 244.8 bits 818,  Expect = 8e-67
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 242.8 bits 811,  Expect = 3e-66
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 24. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 242.8 bits 811,  Expect = 3e-66
 Identities = 125/159 78%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQAIK AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G TI K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 25. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 242.5 bits 810,  Expect = 4e-66
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 240.7 bits 804,  Expect = 1e-65
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL++ IEKI YETKLV+   G TI K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 27. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 240.1 bits 802,  Expect = 2e-65
 Identities = 124/159 77%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG YT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQAIK AEILEG+GGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G TI K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 28. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 239.0 bits 798,  Expect = 5e-65
 Identities = 120/159 75%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E EFTS IPP+RL+ AFVLDADNLIPKIAPQA+K  EILEG+GG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKH+ID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKSISHY
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 237.8 bits 794,  Expect = 1e-64
 Identities = 120/159 75%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 30. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 234.0 bits 781,  Expect = 2e-63
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E E TS IPP+RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA   G +I KSISH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 31. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 230.5 bits 769,  Expect = 2e-62
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E EFTS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 32. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 225.8 bits 753,  Expect = 4e-61
 Identities = 111/159 69%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E EFTS IP  RLFKAF+LD DNLIPKIAPQAIK  +I+EG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 224.9 bits 750,  Expect = 8e-61
 Identities = 111/159 69%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E EFTS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            Y  KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 224.9 bits 750,  Expect = 8e-61
 Identities = 111/159 69%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 220.8 bits 736,  Expect = 1e-59
 Identities = 113/159 71%, Positives = 132/159 83%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T ENE TS IPP RLFKAFVLDADNLIPK+AP+AIK AEI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGSQ+ YVKHRID ID+A+++Y Y++IEGD + + +EKISYE K+VA   G +I K+ S 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG  EIKEE V AGKEKA GLFK +E+YL  H DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 218.2 bits 727,  Expect = 9e-59
 Identities = 110/159 69%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG++T+ +E TS IPP RLFKA+VL+AD LIPKIAPQ++K AEI+EG+GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
            EGS+Y YVKH+ID +D+ ++ Y+Y+L+EGDAL+D +EKISYE KLVA   G S IKS S+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEE VKAGKEKA GLFKLIE+YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 214.6 bits 715,  Expect = 1e-57
 Identities = 108/159 67%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E T+ I P+RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA   G +I KS S 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 206.7 bits 688,  Expect = 2e-55
 Identities = 102/159 64%, Positives = 131/159 82%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IPP+RLFK FVLD+DNLIPK+AP+AIK  EI+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS + Y+K++++ ID+A++SY Y++IEGDAL+D +EKI+YE K+VA   G +I KSIS 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHT G+ E+K+E++KAGKEKA GLFK +E YL  H DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 204.4 bits 680,  Expect = 1e-54
 Identities = 101/159 63%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS I P+RLFK+FVLDADNLIPK+AP+ +  AE +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS++ Y+KHR+D ID A++ Y Y++IEG  L DT+EKISYE K+VA  G GS +K  S 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+I + EE +KAGKEK  GLFK +E+YL  HP+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 40. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 202.1 bits 672,  Expect = 6e-54
 Identities = 101/158 63%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+++E+E TS IPP+RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EGS++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKISYE K+ A   G GS +K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 41. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 202.1 bits 672,  Expect = 6e-54
 Identities = 101/158 63%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IPP+RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EG+++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKISYE K+ A   G GS +K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 201.2 bits 669,  Expect = 1e-53
 Identities = 100/158 63%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+++E+E TS IPP+RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EG+++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKI YE K+ A   G GS +K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 201.2 bits 669,  Expect = 1e-53
 Identities = 101/158 63%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IPP+RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EGS++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKISYE K+ A   G GS +K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 44. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 200.3 bits 666,  Expect = 2e-53
 Identities = 97/159 61%, Positives = 135/159 84%, Gaps = 2/159 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+EFTS I P+RLFKAFVLD DNL+PKIAPQA+++ EILEGNGG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKISYETKLVACGSG-STIKSIS 118
            +G  + YVKH+I++ID+ S +YSY++IEGDAL  + +EKI++E+KLVA G G + IK++S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
             Y++ G+ ++ EE VK G+++A  ++K +E+YLKDHP+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 45. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 195.6 bits 650,  Expect = 5e-52
 Identities = 96/158 60%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 46. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 194.7 bits 647,  Expect = 1e-51
 Identities = 100/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E KLVA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEKA  L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 193.6 bits 643,  Expect = 2e-51
 Identities = 94/158 59%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV  +E+E  S IPP+RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+  + KHRID ID  ++++S+++IEGDAL D +E +S ETK+VA    GS +KS   
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++ +E ++ GKEKA G+FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 48. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 192.7 bits 640,  Expect = 4e-51
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 190.9 bits 634,  Expect = 1e-50
 Identities = 98/158 62%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E+E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-Y 120
            GS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E KLVA   G +I  IS+ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 50. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 189.6 bits 629,  Expect = 3e-50
 Identities = 93/137 67%, Positives = 114/137 83%, Gaps = 0/137 0%
Query  10   FTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVK 69
            +TS IPP +LFKAFVLDADNLIPKIAPQA+K  EI+EG+GG GT+KKI +GEG+++ YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIK 129
            H+ID +D+ ++ YSY++ EGDAL D IEKISYE KLVA G GS IK+ SHYH KG  EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVKAGKEKAHGLFKL 146
            EE+VK GKE+A GLFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 51. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 189.2 bits 628,  Expect = 5e-50
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 188.9 bits 627,  Expect = 6e-50
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 188.6 bits 626,  Expect = 7e-50
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 188.0 bits 624,  Expect = 1e-49
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD +NLIPK+APQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+  EH+K GKEK  GLF+ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 187.7 bits 623,  Expect = 1e-49
 Identities = 94/158 59%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA   G +I KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++ +E ++ GKEKA G+FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 56. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 186.3 bits 618,  Expect = 4e-49
 Identities = 95/158 60%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVY +E++ TS IPP+RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA   G +I KS + 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 57. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 185.4 bits 615,  Expect = 7e-49
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 182.2 bits 604,  Expect = 6e-48
 Identities = 94/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 59. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 182.1 bits 604,  Expect = 6e-48
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 181.9 bits 603,  Expect = 7e-48
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-Y 120
            G  + YVK R+D +D A++ YSY+LIEG  + DT+EKIS E K+VA   G +I  IS+ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 61. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 181.0 bits 600,  Expect = 1e-47
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 180.7 bits 599,  Expect = 2e-47
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 180.7 bits 599,  Expect = 2e-47
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 180.7 bits 599,  Expect = 2e-47
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 180.4 bits 598,  Expect = 2e-47
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 180.4 bits 598,  Expect = 2e-47
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 180.1 bits 597,  Expect = 3e-47
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP +RLFKAF+L+ DNLIPK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 180.1 bits 597,  Expect = 3e-47
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 180.1 bits 597,  Expect = 3e-47
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 179.8 bits 596,  Expect = 3e-47
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 179.2 bits 594,  Expect = 5e-47
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 179.2 bits 594,  Expect = 5e-47
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 178.9 bits 593,  Expect = 6e-47
 Identities = 92/157 58%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA   G +I KS + 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 74. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 178.9 bits 593,  Expect = 6e-47
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 75. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 178.9 bits 593,  Expect = 6e-47
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD +NLIPK+APQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSI-SH 119
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I  I S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 178.3 bits 591,  Expect = 9e-47
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
             G  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 178.3 bits 591,  Expect = 9e-47
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +R+FKAF+LD D L+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 78. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 178.0 bits 590,  Expect = 1e-46
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 177.8 bits 589,  Expect = 1e-46
 Identities = 88/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFKAF+LD D L+PK+AP+A+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D  ++ YS+++IEG A+ D +EK+  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +HTKG+ EI  E++K  KEKA GL+K +ESYL  H DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 80. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 175.8 bits 582,  Expect = 5e-46
 Identities = 89/148 60%, Positives = 114/148 77%, Gaps = 1/148 0%
Query  4    YTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGS 63
            + +E+E TS IP +RLFKAF+L+ DNLIPK+APQAI   E +EGNGGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-YHT 122
             + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            KG+ E+K EH+KA KEK   L++ +ESYL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 81. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 175.7 bits 582,  Expect = 5e-46
 Identities = 87/158 55%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP +RLFKAF+LD D L+PK+AP+A+   E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-Y 120
            GS + YVK R+D +D  ++ YS+++IEG A+ D +EK+  E K+VA   G +I  IS+ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+ EI  E++K  KEKA GL+K +ESYL  H DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 82. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 175.7 bits 582,  Expect = 5e-46
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 83. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 175.1 bits 580,  Expect = 8e-46
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSI-SH 119
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I  I S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 174.5 bits 578,  Expect = 1e-45
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 174.2 bits 577,  Expect = 1e-45
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 86. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 174.0 bits 576,  Expect = 2e-45
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 87. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 173.7 bits 575,  Expect = 2e-45
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 88. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 173.4 bits 574,  Expect = 3e-45
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 89. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 171.6 bits 568,  Expect = 9e-45
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 171.3 bits 567,  Expect = 1e-44
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 171.3 bits 567,  Expect = 1e-44
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 171.3 bits 567,  Expect = 1e-44
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 170.7 bits 565,  Expect = 2e-44
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 170.4 bits 564,  Expect = 2e-44
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 170.1 bits 563,  Expect = 3e-44
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EG  + +VK R+D +D A++ YSYT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 169.9 bits 562,  Expect = 3e-44
 Identities = 85/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            GS   YVK R++ ID  ++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG  E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 97. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 169.9 bits 562,  Expect = 3e-44
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S I  +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 98. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 168.7 bits 558,  Expect = 7e-44
 Identities = 83/156 53%, Positives = 118/156 75%, Gaps = 1/156 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 99. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 168.1 bits 556,  Expect = 1e-43
 Identities = 84/158 53%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            GS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG  E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 100. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 167.5 bits 554,  Expect = 2e-43
 Identities = 84/159 52%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E K+VA  G GS +K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 164.6 bits 544,  Expect = 1e-42
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 164.3 bits 543,  Expect = 1e-42
 Identities = 82/158 51%, Positives = 108/158 68%, Gaps = 1/158 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQ I   E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            G  + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG  E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 164.0 bits 542,  Expect = 2e-42
 Identities = 83/148 56%, Positives = 107/148 72%, Gaps = 1/148 0%
Query  4    YTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGS 63
            + +E E TS IP +RLFKAF+LD DNL PK+APQAI   + +EGNGGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-YHT 122
             + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  I  IS+ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            KGN E+K E+VKA KE    L++ +ESYL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 157.6 bits 520,  Expect = 2e-40
 Identities = 84/157 53%, Positives = 114/157 72%, Gaps = 3/157 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE+E  S + P+ L+KA+V DADN+IPK A  + K  E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  +V H+I+SIDEA+  YSY+++ G AL DT EKI++++KLVA  +G +   ++  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            Y TKG+ E  ++ +K GK KA  LFK IE+YL  HPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 105. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 151.4 bits 499,  Expect = 1e-38
 Identities = 77/156 49%, Positives = 113/156 72%, Gaps = 3/156 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 106. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 151.1 bits 498,  Expect = 1e-38
 Identities = 80/155 51%, Positives = 107/155 69%, Gaps = 2/155 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  T++ E  S I   ++FKAFVLD D +IPK  P+AI   + LEG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS +  VKHRID +D+ +++YSY++IEG AL D  E ISY  K+VA   G  I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156
            Y  K + ++ EE +KAGKE+A G+FK +E+YL  +PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 107. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 150.0 bits 494,  Expect = 3e-38
 Identities = 76/150 50%, Positives = 108/150 72%, Gaps = 1/150 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE E TS +PP++LFKA V+D D L PK+ P AI+  EI+EGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            E  +  YV H+ID+IDEA+Y+Y YT+  G  + + +EK+S++TKL A   GS IK    +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            HTKG+  + +E  +  K+K++G+FK IE Y+
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYV 150

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 148.2 bits 488,  Expect = 1e-37
 Identities = 74/155 47%, Positives = 109/155 70%, Gaps = 1/155 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL    +G ++  +S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 146.5 bits 482,  Expect = 3e-37
 Identities = 76/154 49%, Positives = 110/154 71%, Gaps = 2/154 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 146.2 bits 481,  Expect = 4e-37
 Identities = 73/154 47%, Positives = 108/154 70%, Gaps = 1/154 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL    +G ++  +S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 145.3 bits 478,  Expect = 8e-37
 Identities = 75/158 47%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 140.3 bits 461,  Expect = 2e-35
 Identities = 74/154 48%, Positives = 106/154 68%, Gaps = 2/154 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            M V+TF+++ TS + P+ L+ A+  DADN+IPK A  + +  EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
            E  +  +V H+I+S+DEA+  YSY+++ G AL DT EKI+ +TK+      GS IK    
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            YH KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 137.6 bits 452,  Expect = 2e-34
 Identities = 69/158 43%, Positives = 103/158 65%, Gaps = 1/158 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 128.2 bits 420,  Expect = 1e-31
 Identities = 64/145 44%, Positives = 95/145 65%, Gaps = 1/145 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T+  E T+ I P+RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFK 145
            YHTKG+  + EE    G+ + H  F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 124.5 bits 407,  Expect = 1e-30
 Identities = 62/151 41%, Positives = 102/151 67%, Gaps = 1/151 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV   E   TS +P ++LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 121.0 bits 395,  Expect = 2e-29
 Identities = 59/151 39%, Positives = 94/151 62%, Gaps = 0/151 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV     E  S +   ++++ F+LD D + PK+ PQ IK  EILEG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            E ++Y  +K+++D ID+A  +Y+YT I GD L D +E +  E  +V    G  +K+ + Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +TKG+  + E+ +K   EK+   FK +E+YL
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYL 151

Sequence Alignment: 117. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 119.8 bits 391,  Expect = 4e-29
 Identities = 62/155 40%, Positives = 94/155 60%, Gaps = 3/155 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            M V  FE   TS + PS +FKAFV+D D + PK  P+  K  + +EG+GG GTIK IT+ 
Sbjct  1    MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            +G  +   KH++D+ID  ++S SYT+ EGD L   IE  ++  K++    G ++   S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDA 157
            +  KG+ ++ +E+V   KE     FK IE+Y+  HP+A
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 119.2 bits 389,  Expect = 5e-29
 Identities = 58/151 38%, Positives = 94/151 62%, Gaps = 0/151 0%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV   E E  S +   ++++ F+LD D + PK+ PQ IK  EILEG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            E ++Y  +K+++D ID+A   Y+YT I GD L + +E +  +  +V    G  +K+ + Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +TKG+  + E+ VK   EK+   FK +E+YL
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYL 151

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 114.8 bits 374,  Expect = 1e-27
 Identities = 60/150 40%, Positives = 94/150 62%, Gaps = 2/150 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T   E+TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151

Sequence Alignment: 120. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 110.2 bits 357,  Expect = 2e-26
 Identities = 81/99 81%, Positives = 88/99 88%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYS 81
            AFVLDADNLIPK                      KITFGEGSQYGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKAGKEKA 140
                 +EGDAL+DT+EKI YETKLV+  S STI K+ S YHTKG++EIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  HGLFKLIESYLKDHPDAYN 159
              LFKLIE YLKDHP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 105.8 bits 343,  Expect = 6e-25
 Identities = 60/148 40%, Positives = 91/148 61%, Gaps = 6/148 4%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGS---GSTIKSI 117
            EGS    +  R D++++ + +Y  T+I+GD L   IE I  ET LV   +   GS  K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            + +HTKG+  + EE++K   E+   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYL 151

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 104.9 bits 340,  Expect = 1e-24
 Identities = 60/148 40%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGS---GSTIKSI 117
            EGS    +  R D++++ + +Y  T+I+GD L   IE I  ET LV   +   GS  K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            + +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 123. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 104.3 bits 338,  Expect = 2e-24
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 103.6 bits 336,  Expect = 3e-24
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 165

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 102.2 bits 331,  Expect = 7e-24
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 70.4 bits 219,  Expect = 8e-15
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 53.0 bits 163,  Expect = 4e-09
 Identities = 41/144 28%, Positives = 67/144 46%, Gaps = 6/144 4%
Query  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
Query  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTK 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
Query  124  GNIEIKEEHVKAGKEKAHGLFKLIESYLKD 153
             +IE K    K  +     L +L E YL +
Sbjct  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYLSN 152

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 38.8 bits 109,  Expect = 1e-05
 Identities = 17/24 70%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVYTFENEFTSEIPPSRLFKAFVL 25
            GV+T E++ TS IPP+RLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.