The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD26558 Mal d 1.0205 159 1034 279.6 2.8e-77
AAD26545 Mal d 1.0202 159 1025 277.2 1.5e-76
AAB01362 Mal d 1.0201 159 1025 277.2 1.5e-76
AAD26548 Mal d 1.0204 159 1021 276.2 3e-76
AAD13683 Mal d 1.0206 159 1020 275.9 3.6e-76
AAK13030 Mal d 1.0207 159 1019 275.6 4.4e-76
AAD26547 Mal d 1.0203 159 1019 275.6 4.4e-76
CAD32318 Mal d 1.0208 158 997 269.8 2.4e-74
O65200 Pyr c 1 159 978 264.8 7.8e-73
AAD26552 Mal d 1.0104 159 967 261.9 5.9e-72
AAD26546 Mal d 1.0103 159 961 260.3 1.8e-71
AAD26555 Mal d 1.0107 159 958 259.6 3e-71
AAD29671 Mal d 1.0108 159 952 258.0 9.1e-71
CAA58646 Mal d 1.0101 159 947 256.7 2.3e-70
AAD26554 Mal d 1.0106 159 946 256.4 2.7e-70
CAA88833 Mal d 1.0102 159 941 255.1 6.8e-70
AAD26553 Mal d 1.0105 159 941 255.1 6.8e-70
AAK13029 Mal d 1.0109 159 936 253.8 1.7e-69
O24248 Pru av 1 160 919 249.3 3.8e-68
Q2I6V8 Pru p 1.0101 160 914 247.9 9.5e-68
Q256S4 Fra a 1 159 832 226.3 3e-61
AAO25113 Mal d 1.0304 159 827 225.0 7.5e-61
Q256S7 Fra a 1 160 824 224.2 1.3e-60
Q3T923 Fra a 1 160 822 223.7 1.9e-60
Q256S2 Fra a 1 160 817 222.4 4.7e-60
Q256S6 Fra a 1 160 815 221.9 6.8e-60
AAK13027 Mal d 1.0302 159 811 220.8 1.4e-59
AAK13028 Mal d 1.0303 159 809 220.3 2e-59
CAA96534 Mal d 1.0301 159 805 219.2 4.2e-59
APD76154 Jug r 5.0101 160 790 215.3 6.5e-58
O50001 Pru ar 1 160 780 212.6 4.1e-57
CAA96535 Mal d 1.0401 160 775 211.3 1e-56
CAA96536 Mal d 1.0402 160 774 211.0 1.2e-56
CAA96537 Mal d 1.0403 160 771 210.3 2.1e-56
B6CQS9 Pru du 1.0101 160 758 206.8 2.3e-55
CAD10374 Cas s 1 160 752 205.2 6.8e-55
ACJ23864 Fag s 1.0101 160 727 198.7 6.5e-53
CAA96549 Cor a 1.0301 160 698 191.0 1.3e-50
CAA54696.1 Bet v 1.0301 160 680 186.3 3.5e-49
AAG40329 Cor a 1.0402 161 671 183.9 1.8e-48
AAD48405 Cor a 1.0401 161 670 183.6 2.2e-48
AAG40330 Cor a 1.0403 161 668 183.1 3.2e-48
AAG40331 Cor a 1.0404 161 667 182.8 3.8e-48
Q0Z8U9 Rub i 1.0101 137 656 180.1 2.2e-47
ABZ81046 Que a 1.0301 160 656 179.9 2.8e-47
AUH28179 Que m 1.0101 160 649 178.1 1e-46
AFN42528 Can s 5.0101 161 646 177.3 1.8e-46
Q39427 Bet v 1.0205 160 639 175.5 6.3e-46
P43186 Bet v 1.0204 160 632 173.6 2.3e-45
CAA04828.1 Bet v 1.0206 159 626 172.0 6.7e-45
ABZ81047 Que a 1.0401 160 625 171.8 8.1e-45
CAA54481 Bet v 1.0202 160 620 170.5 2e-44
P43184 Bet v 1.0203 160 619 170.2 2.4e-44
CAA54421 Bet v 1.0201 160 618 169.9 2.9e-44
QOL10866 Que ac 1.0101 159 617 169.7 3.5e-44
CAA96548 Cor a 1.0201 160 616 169.4 4.2e-44
QGS84240 Que i 1.0101 159 607 167.0 2.2e-43
CAA07329.1 Bet v 1.0118 160 605 166.5 3.1e-43
ABZ81045 Que a 1.0201 159 601 165.5 6.4e-43
CAB02160 Bet v 1.0113 160 598 164.7 1.1e-42
CAA04827.1 Bet v 1.0116 159 596 164.1 1.6e-42
CAA54487 Bet v 1.0106 160 594 163.6 2.3e-42
CAA33887 Bet v 1.0101 160 593 163.3 2.8e-42
CAA54483 Bet v 1.0103 160 593 163.3 2.8e-42
CAB02159 Bet v 1.0112 160 593 163.3 2.8e-42
CAA50325 Cor a 1.0103 160 593 163.3 2.8e-42
CAB02156 Bet v 1.0109 160 592 163.1 3.4e-42
CAB02161 Bet v 1.0114 160 591 162.8 4e-42
CAA54484 Bet v 1.0104 160 591 162.8 4e-42
CAB02217 Car b 1.0302 161 591 162.8 4.1e-42
CAA07323.1 Bet v 1.0117 160 583 160.7 1.7e-41
CAB02155 Bet v 1.0108 160 582 160.4 2.1e-41
CAA96547 Bet v 1.0115 160 582 160.4 2.1e-41
AAB24432 Aln g 1 160 582 160.4 2.1e-41
CAA50327 Cor a 1.0101 160 582 160.4 2.1e-41
CAA54482 Bet v 1.0102 160 581 160.2 2.5e-41
CAA54485 Bet v 1.0105 160 580 159.9 3e-41
CAB02207 Car b 1.0104 160 580 159.9 3e-41
CAB02206 Car b 1.0103 160 579 159.6 3.6e-41
CAB02216 Car b 1.0301 161 578 159.4 4.4e-41
CAB02157 Bet v 1.0110 160 577 159.1 5.2e-41
CAA50328 Cor a 1.0102 160 576 158.9 6.3e-41
CAB02208 Car b 1.0105 160 576 158.9 6.3e-41
Q08407 Cor a 1 159 575 158.6 7.4e-41
P38948 Aln g 1 159 575 158.6 7.4e-41
CAA54489 Bet v 1.0107 160 575 158.6 7.5e-41
CAB02158 Bet v 1.0111 160 574 158.3 9e-41
ACF75030.1 Bet v 1.0207 150 572 157.9 1.2e-40
ABZ81043 Car b 1.0112 160 569 157.0 2.3e-40
ABZ81042 Car b 1.0111 160 569 157.0 2.3e-40
ADK39021 Ost c 1.0101 160 568 156.7 2.7e-40
ABZ81041 Car b 1.0110 160 568 156.7 2.7e-40
ABZ81040 Car b 1.0109 160 567 156.5 3.2e-40
CAB02209 Car b 1.0106 160 566 156.2 3.9e-40
ABZ81044 Car b 1.0113 160 563 155.4 6.7e-40
P38950 Car b 1 159 555 153.3 2.9e-39
CAB02213 Car b 1.0107 160 554 153.1 3.5e-39
CAA47357 Car b 1.0102 159 551 152.3 6e-39
CAA50326 Cor a 1.0104 160 550 152.0 7.2e-39
CAM31908 Act c 8.0101 159 547 151.2 1.2e-38
CAB02215 Car b 1.0108 160 544 150.4 2.2e-38
P38949 Car b 1 159 538 148.8 6.4e-38
ABC41615.1 Bet v 1.0119 150 523 144.9 9.1e-37
CAA42646 Gly m 4 158 516 143.1 3.5e-36
CAM31909 Act d 8.0101 157 502 139.4 4.5e-35
AAQ91847 Ara h 8.0101 157 496 137.8 1.4e-34
NP_001275580 Sola l 4.0201 160 494 137.2 2e-34
EF436550 Ara h 8.0201 153 491 136.5 3.2e-34
CAA43637 Pha v 1 156 490 136.2 4e-34
CAA43636 Pha v 1 155 483 134.4 1.4e-33
P25985 Pha v 1 155 483 134.4 1.4e-33
AHC08073 Sola l 4.0101 160 472 131.4 1.1e-32
Q2VU97 Vig r 1.0101 155 465 129.6 3.8e-32
CAA75803 Lyc e 4.0101 178 438 122.4 6.6e-30
P92918 Api g 1.0201 159 410 115.1 9.2e-28
AAL76932 Dau c 1.0201 154 404 113.5 2.6e-27
AAB92255 Tar o RAP 157 404 113.5 2.7e-27
CAA67246 Pet c PR10 155 401 112.8 4.6e-27
P49372 Api g 1 154 372 105.1 9.1e-25
Q5ULZ4 Fra a 1.0101 100 349 99.4 3.1e-23
CAB03716 Dau c 1.0104 154 345 98.0 1.3e-22
CAB06416 Dau c 1.0105 154 342 97.2 2.2e-22
BAA13604 Dau c 1.0102 154 339 96.4 3.8e-22
AAB01092 Dau c 1.0101 168 337 95.8 6.2e-22
CAB03715 Dau c 1.0103 154 332 94.6 1.4e-21
P85126 Que a 1.0101 50 212 63.8 8e-13
Q9ZWP8 Vig r 6.0101 155 160 49.2 6.1e-08
Q9S8Q4 Cas s 1 24 108 37.0 4.6e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 279.6 bits 1034,  Expect = 3e-77
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 2. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 277.2 bits 1025,  Expect = 1e-76
 Identities = 158/159 99%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 3. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 277.2 bits 1025,  Expect = 1e-76
 Identities = 158/159 99%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 276.2 bits 1021,  Expect = 3e-76
 Identities = 157/159 98%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKL+ASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 5. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 275.9 bits 1020,  Expect = 4e-76
 Identities = 157/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFK FVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 6. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 275.6 bits 1019,  Expect = 4e-76
 Identities = 157/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 7. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 275.6 bits 1019,  Expect = 4e-76
 Identities = 157/159 98%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKAHGLFKLIES+LKGHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 8. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 269.8 bits 997,  Expect = 2e-74
 Identities = 154/158 97%, Positives = 155/158 98%, Gaps = 0/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GVYT+ENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 121
            GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            TKGDVEI EEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 9. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 264.8 bits 978,  Expect = 8e-73
 Identities = 146/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG+YTFENE+TSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEG+GGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH++DS+DEA+YSYAYTLIEGDALTDTIEK+SYE KLVASGSGS IKSISHY
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGD+EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 261.9 bits 967,  Expect = 6e-72
 Identities = 146/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 260.3 bits 961,  Expect = 2e-71
 Identities = 145/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 259.6 bits 958,  Expect = 3e-71
 Identities = 145/159 91%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENEYTSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV AGK KAHGLFKLIESYLKGHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 258.0 bits 952,  Expect = 9e-71
 Identities = 144/159 90%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 256.7 bits 947,  Expect = 2e-70
 Identities = 143/159 89%, Positives = 153/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV  GKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 256.4 bits 946,  Expect = 3e-70
 Identities = 143/159 89%, Positives = 153/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIE +SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 255.1 bits 941,  Expect = 7e-70
 Identities = 141/159 88%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSG+ IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            H KG++EIKEEHV  GKEK HGLFKLIESYLKGHPDAYN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 255.1 bits 941,  Expect = 7e-70
 Identities = 143/159 89%, Positives = 153/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV TFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 253.8 bits 936,  Expect = 2e-69
 Identities = 142/159 89%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV TFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKG++EIKEEHV  GKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 19. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 249.3 bits 919,  Expect = 4e-68
 Identities = 139/159 87%, Positives = 152/159 95%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
            EGSQYGYVKHKIDS+D+ NYSY+YTLIEGDAL DT+EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+VEIKEEHV AGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 20. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 247.9 bits 914,  Expect = 9e-68
 Identities = 138/159 86%, Positives = 151/159 94%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIKH+EILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
            EGSQYGYVKHKIDS+D+ N+SY+YTLIEGDAL D +EK+SYETKLVAS SG SIIKS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEEHV AGKEKA  LFKLIE+YLKGHPDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 226.3 bits 832,  Expect = 3e-61
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 225.0 bits 827,  Expect = 8e-61
 Identities = 125/159 78%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 23. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 224.2 bits 824,  Expect = 1e-60
 Identities = 126/159 79%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQAIK AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G+IIK+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 24. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 223.7 bits 822,  Expect = 2e-60
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 25. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 222.4 bits 817,  Expect = 5e-60
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL++ IEK+ YETKLV A   G+IIK+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 221.9 bits 815,  Expect = 7e-60
 Identities = 125/159 78%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG YT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQAIK AEILEGDGGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G+IIK+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 27. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 220.8 bits 811,  Expect = 1e-59
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVA+GSGS+IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 220.3 bits 809,  Expect = 2e-59
 Identities = 124/159 77%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E E+TS IPP RL+ AFVLDADNLIPKIAPQA+K  EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGS Y YVKHKID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKSISHY
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 219.2 bits 805,  Expect = 4e-59
 Identities = 122/159 76%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTK DVEIKEEHV AGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 30. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 215.3 bits 790,  Expect = 7e-58
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
            EGSQY YVKH+ D++DEAN++YAY++IEGDAL D IEK+SYETK+VAS   GSI+KSISH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YH+KGD EIKEE V  GKEKA GLFK +E YL  HPDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 31. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 212.6 bits 780,  Expect = 4e-57
 Identities = 115/159 72%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEGDGG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGSQY YVKH++D +D+ N SY+YTLIEGDAL+D IE ++Y+ KLVAS   GSI+K+ SH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEE+V AGKEKA GLFKL+E+YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 32. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 211.3 bits 775,  Expect = 1e-56
 Identities = 113/159 71%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YH KGDVEIKEEHV AGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 211.0 bits 774,  Expect = 1e-56
 Identities = 112/159 70%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E+TS IP PRLFKAF+LD DNLIPKIAPQAIK  +I+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YH KGDVEIKEEHV AGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 210.3 bits 771,  Expect = 2e-56
 Identities = 112/159 70%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E+TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            Y  KGDVEIKEEHV AGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 206.8 bits 758,  Expect = 2e-55
 Identities = 114/159 71%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG++T+ +E TS IPPPRLFKA+VL+AD LIPKIAPQ++K AEI+EGDGG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
            EGS+Y YVKH+ID +D+ N+ Y Y+L+EGDAL+D +EK+SYE KLVAS  G S+IKS S+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGDVEIKEE V AGKEKA GLFKLIE+YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 205.2 bits 752,  Expect = 7e-55
 Identities = 113/159 71%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T ENE TS IPP RLFKAFVLDADNLIPK+AP+AIK AEI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGSQ+ YVKH+ID +D+AN++Y Y++IEGD + + +EK+SYE K+VAS   GSI+K+ S 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ EIKEE VMAGKEKA GLFK +E+YL  H DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 198.7 bits 727,  Expect = 7e-53
 Identities = 109/159 68%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGSQ+ YVKH+ID +D AN++YA TLIEGDA+++T+EK++YE KLVAS   GSI+KS S 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD EIKE+++ AGKE+A G+FK +E+YL  +P AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 191.0 bits 698,  Expect = 1e-50
 Identities = 103/159 64%, Positives = 131/159 82%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IPP RLFK FVLD+DNLIPK+AP+AIK  EI+EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASG-SGSIIKSISH 119
            EGS + Y+K+K++ +D+AN+SY Y++IEGDAL+D +EK++YE K+VAS   GSI+KSIS 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHT GD E+K+E++ AGKEKA GLFK +E YL  H DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 186.3 bits 680,  Expect = 4e-49
 Identities = 98/159 61%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS I P RLFK+FVLDADNLIPK+AP+ +  AE +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS++ Y+KH++D +D AN+ Y Y++IEG  L DT+EK+SYE K+VA+ G GSI+K  S 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD+ + EE + AGKEK  GLFK +E+YL  HP+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 40. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 183.9 bits 671,  Expect = 2e-48
 Identities = 99/158 62%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+++E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS--GSGSIIKSIS 118
            EGS++ Y+KHK++ +D AN+ Y Y++IEG  L  T+EK+SYE K+ A+  G GSI+K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
             YHTKG+  I EE + AGKEKA GLFK +E+YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 41. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 183.6 bits 670,  Expect = 2e-48
 Identities = 99/158 62%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS--GSGSIIKSIS 118
            EG+++ Y+KHK++ +D AN+ Y Y++IEG  L  T+EK+SYE K+ A+  G GSI+K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
             YHTKG+  I EE + AGKEKA GLFK +E+YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 183.1 bits 668,  Expect = 3e-48
 Identities = 99/158 62%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS--GSGSIIKSIS 118
            EGS++ Y+KHK++ +D AN+ Y Y++IEG  L  T+EK+SYE K+ A+  G GSI+K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
             YHTKG+  I EE + AGKEKA GLFK +E+YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 182.8 bits 667,  Expect = 4e-48
 Identities = 98/158 62%, Positives = 124/158 78%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+++E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS--GSGSIIKSIS 118
            EG+++ Y+KHK++ +D AN+ Y Y++IEG  L  T+EK+ YE K+ A+  G GSI+K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
             YHTKG+  I EE + AGKEKA GLFK +E+YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 44. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 180.1 bits 656,  Expect = 2e-47
 Identities = 97/137 70%, Positives = 116/137 84%, Gaps = 0/137 0%
Query  10   YTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVK 69
            YTS IPPP+LFKAFVLDADNLIPKIAPQA+K  EI+EGDGG GT+KKI +GEG+++ YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYHTKGDVEIK 129
            HKID +D+ N+ Y+Y++ EGDAL D IEK+SYE KLVASG GSIIK+ SHYH KG  EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVMAGKEKAHGLFKL 146
            EE+V  GKE+A GLFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 45. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 179.9 bits 656,  Expect = 3e-47
 Identities = 97/158 61%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI+KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            Y+TKGD ++ +E +  GKEKA  +FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 46. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 178.1 bits 649,  Expect = 1e-46
 Identities = 95/158 60%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV  +E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+  + KH+ID +D  N+++++++IEGDAL D +E VS ETK+VAS   GSI+KS   
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            Y+TKGD ++ +E +  GKEKA G+FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 47. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 177.3 bits 646,  Expect = 2e-46
 Identities = 92/159 57%, Positives = 133/159 83%, Gaps = 2/159 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E+TS I P RLFKAFVLD DNL+PKIAPQA++  EILEG+GG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALT-DTIEKVSYETKLVASGSG-SIIKSIS 118
            +G  + YVKHKI+++D+ + +Y+Y++IEGDAL  + +EK+++E+KLVASG G ++IK++S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  HYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
             Y++ GD ++ EE V  G+++A  ++K +E+YLK HP+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 48. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 175.5 bits 639,  Expect = 6e-46
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E KLVA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K EH+ A KEKA  L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 173.6 bits 632,  Expect = 2e-45
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 172.0 bits 626,  Expect = 7e-45
 Identities = 96/158 60%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E+E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            GS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E KLVA+   GSI+K  + Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 51. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 171.8 bits 625,  Expect = 8e-45
 Identities = 95/158 60%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+  + KH+ID +D  N++Y++++IEGDAL D +E VS ETK+VAS   GSI KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            Y+TKGD ++ +E +  GKEKA G+FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 52. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 170.5 bits 620,  Expect = 2e-44
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 170.2 bits 619,  Expect = 2e-44
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 169.9 bits 618,  Expect = 3e-44
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 169.7 bits 617,  Expect = 3e-44
 Identities = 94/158 59%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            E S+  Y KH+ID++D  N SY++++IEG+ALTD I  +S E K+VAS   GSI+KS + 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            Y+TKG  ++KEE++ A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 56. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 169.4 bits 616,  Expect = 4e-44
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD +NLIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+  EH+  GKEK  GLF+ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 167.0 bits 607,  Expect = 2e-43
 Identities = 96/157 61%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            Y+TKGD ++KEE++ A  EK  GL K +E+YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 58. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 166.5 bits 605,  Expect = 3e-43
 Identities = 93/159 58%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+  G  I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 165.5 bits 601,  Expect = 6e-43
 Identities = 94/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            E S++ Y KH+ID++D  N +Y++++IEGDALT  +E VS E K VAS   GSI+KS + 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            Y+TKGD ++KEE++ A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 60. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 164.7 bits 598,  Expect = 1e-42
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 164.1 bits 596,  Expect = 2e-42
 Identities = 91/158 57%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            G  + YVK ++D VD AN+ Y+Y+LIEG  + DT+EK+S E K+VA+   GSI+K  + Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGD E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 62. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 163.6 bits 594,  Expect = 2e-42
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E++ A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 163.3 bits 593,  Expect = 3e-42
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 163.3 bits 593,  Expect = 3e-42
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E++ A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 163.3 bits 593,  Expect = 3e-42
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 163.3 bits 593,  Expect = 3e-42
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 163.1 bits 592,  Expect = 3e-42
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 162.8 bits 591,  Expect = 4e-42
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 162.8 bits 591,  Expect = 4e-42
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E++ A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 162.8 bits 591,  Expect = 4e-42
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD +NLIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+  EH+  GKE+  GL+K +E+YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 160.7 bits 583,  Expect = 2e-41
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 160.4 bits 582,  Expect = 2e-41
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 160.4 bits 582,  Expect = 2e-41
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+K E++ A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 160.4 bits 582,  Expect = 2e-41
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFKAF+LD D L+PK+AP+A+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + YVK ++D VD  N+ Y++++IEG A+ D +EKV  E K+VA+   GSI+K  + 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +HTKGD EI  E++   KEKA GL+K +ESYL  H DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 160.4 bits 582,  Expect = 2e-41
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 160.2 bits 581,  Expect = 3e-41
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 159.9 bits 580,  Expect = 3e-41
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+L+ DNLIPK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 78. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 159.9 bits 580,  Expect = 3e-41
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 79. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 159.6 bits 579,  Expect = 4e-41
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 80. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 159.4 bits 578,  Expect = 4e-41
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKGD E+  EH+  GKE+  GL+K +E+YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 81. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 159.1 bits 577,  Expect = 5e-41
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + D +EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 82. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 158.9 bits 576,  Expect = 6e-41
 Identities = 89/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GSI+K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 83. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 158.9 bits 576,  Expect = 6e-41
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 84. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 158.6 bits 575,  Expect = 7e-41
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 85. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 158.6 bits 575,  Expect = 7e-41
 Identities = 87/158 55%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFKAF+LD D L+PK+AP+A+   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            GS + YVK ++D VD  N+ Y++++IEG A+ D +EKV  E K+VA+   GSI+K  + +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            HTKGD EI  E++   KEKA GL+K +ESYL  H DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 86. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 158.6 bits 575,  Expect = 8e-41
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  R+FKAF+LD D L+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 87. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 158.3 bits 574,  Expect = 9e-41
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
             G  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 88. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 157.9 bits 572,  Expect = 1e-40
 Identities = 87/148 58%, Positives = 113/148 76%, Gaps = 1/148 0%
Query  4    YTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGS 63
            + +E+E TS IP  RLFKAF+L+ DNLIPK+APQAI   E +EG+GGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHYHT 122
             + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            KGD E+K EH+ A KEK   L++ +ESYL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 89. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 157.0 bits 569,  Expect = 2e-40
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 157.0 bits 569,  Expect = 2e-40
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 156.7 bits 568,  Expect = 3e-40
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 156.7 bits 568,  Expect = 3e-40
 Identities = 86/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GS++K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 156.5 bits 567,  Expect = 3e-40
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 156.2 bits 566,  Expect = 4e-40
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 155.4 bits 563,  Expect = 7e-40
 Identities = 86/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EG  + +VK ++D VD AN+ Y+YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 153.3 bits 555,  Expect = 3e-39
 Identities = 84/158 53%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            GS   YVK +++ +D  N+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            H KG  E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 97. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 153.1 bits 554,  Expect = 3e-39
 Identities = 85/159 53%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E K+VA+ G GSI+K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 98. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 152.3 bits 551,  Expect = 6e-39
 Identities = 85/158 53%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            GS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            H KG  E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 99. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 152.0 bits 550,  Expect = 7e-39
 Identities = 86/159 54%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS+Y YVK ++D VD  N+ Y+YT+IEGD L D +EKV  E K+VA+ G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 100. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 151.2 bits 547,  Expect = 1e-38
 Identities = 81/156 51%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPD 156
            Y TKGD ++ EE +  GKEKA  +FK +E+YL  +PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 150.4 bits 544,  Expect = 2e-38
 Identities = 83/159 52%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 148.8 bits 538,  Expect = 6e-38
 Identities = 83/158 52%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQ I   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
            G  + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            H KG  E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 144.9 bits 523,  Expect = 9e-37
 Identities = 80/148 54%, Positives = 105/148 70%, Gaps = 1/148 0%
Query  4    YTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGS 63
            + +E E TS IP  RLFKAF+LD DNL PK+APQAI   + +EG+GGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH-YHT 122
             + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  I  IS+ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            KG+ E+K E+V A KE    L++ +ESYL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 143.1 bits 516,  Expect = 4e-36
 Identities = 84/157 53%, Positives = 110/157 70%, Gaps = 3/157 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+TFE+E  S + P  L+KA+V DADN+IPK A  + K  E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL DT EK+++++KLVA    GS  K    
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159
            Y TKGD E  ++ +  GK KA  LFK IE+YL  HPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 105. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 139.4 bits 502,  Expect = 5e-35
 Identities = 79/155 50%, Positives = 107/155 69%, Gaps = 2/155 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG  T++ E  S I   ++FKAFVLD D +IPK  P+AI   + LEGDGG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
            EGS +  VKH+ID +D+ N++Y+Y++IEG AL D  E +SY  K+VA+  G  I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPD 156
            Y  K D ++ EE + AGKE+A G+FK +E+YL  +PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 106. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 137.8 bits 496,  Expect = 1e-34
 Identities = 78/156 50%, Positives = 108/156 69%, Gaps = 3/156 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            YHTKGD +  EE +  GK K  GLF+ IE Y+  +P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 137.2 bits 494,  Expect = 2e-34
 Identities = 77/158 48%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 136.5 bits 491,  Expect = 3e-34
 Identities = 77/150 51%, Positives = 106/150 70%, Gaps = 1/150 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+TFE E TS +PP +LFKA V+D D L PK+ P AI+  EI+EG+GGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            E  +  YV HKID++DEA Y+Y YT+  G  + + +EKVS++TKL A+  GS IK    +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            HTKGD  + +E     K+K++G+FK IE Y+
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYV 150

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 136.2 bits 490,  Expect = 4e-34
 Identities = 74/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
            E  +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155
            YH+KGD    E+ + AGK K+  LFK +E+YL  +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 134.4 bits 483,  Expect = 1e-33
 Identities = 75/154 48%, Positives = 107/154 69%, Gaps = 2/154 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155
            YH+KGD    E+ + AGK K+  LFK+IE+YL  +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 134.4 bits 483,  Expect = 1e-33
 Identities = 73/154 47%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155
            H+KGD    E+ + AGK K+  LFK +E+YL  +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 131.4 bits 472,  Expect = 1e-32
 Identities = 71/158 44%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158
            YHTKGD  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 129.6 bits 465,  Expect = 4e-32
 Identities = 75/153 49%, Positives = 108/153 70%, Gaps = 4/153 2%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            M V+TF+++ TS + P  L+ A+  DADN+IPK A  + +  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGS--GSIIKSIS 118
            E  +  +V HKI+SVDEAN  Y+Y+++ G AL DT EK++ +TK ++ G+  GS+IK   
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTK-ISDGADGGSLIKLTI 118
Query  119  HYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155
             YH KGD    E+ + AGK K+  LFK +E+YL  +P
Sbjct  119  SYHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 122.4 bits 438,  Expect = 7e-30
 Identities = 66/145 45%, Positives = 96/145 66%, Gaps = 1/145 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K+ E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
            EG    Y+KHKI  +D+ N    Y+LIEGD L + +E ++Y+ K+ A+ +G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFK 145
            YHTKGD  + EE    G+ + H  F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 115.1 bits 410,  Expect = 9e-28
 Identities = 62/151 41%, Positives = 94/151 62%, Gaps = 0/151 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV     E  S +   ++++ F+LD D + PK+ PQ IK  EILEGDGG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            E ++Y  +K+K+D +D+A  +Y YT I GD L D +E V  E  +V +  G I+K+ + Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            +TKGD  + E+ +    EK+   FK +E+YL
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYL 151

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 113.5 bits 404,  Expect = 3e-27
 Identities = 61/151 40%, Positives = 94/151 62%, Gaps = 0/151 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV   E E  S +   ++++ F+LD D + PK+ PQ IK  EILEGDGG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
            E ++Y  +K+K+D +D+A   Y YT I GD L + +E V  +  +V +  G I+K+ + Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            +TKGD  + E+ V    EK+   FK +E+YL
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYL 151

Sequence Alignment: 117. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 113.5 bits 404,  Expect = 3e-27
 Identities = 65/155 41%, Positives = 94/155 60%, Gaps = 3/155 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            M V  FE   TS + P  +FKAFV+D D + PK  P+  K  + +EGDGG GTIK IT+ 
Sbjct  1    MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
            +G  +   KHK+D++D  N+S +YT+ EGD L   IE  ++  K++ S  G S+ K    
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDA 157
            +  KGD ++ +E+V   KE     FK IE+Y+  HP+A
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 118. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 112.8 bits 401,  Expect = 5e-27
 Identities = 60/151 39%, Positives = 99/151 65%, Gaps = 1/151 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEGDGG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGS-IIKSISH 119
            + S Y  +K+KID++D+  ++++Y++I+GD L   I+ ++    +V +  G     S + 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            ++TKGD  + EE++    ++ + +FK +E+YL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 105.1 bits 372,  Expect = 9e-25
 Identities = 61/150 40%, Positives = 92/150 61%, Gaps = 2/150 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
            +G     +  +ID V++   ++ Y++I+GD L   IE +     LV +  G SI K+ + 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            +HTKGD  + EE++    E+   LFK +E+YL
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151

Sequence Alignment: 120. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 99.4 bits 349,  Expect = 3e-23
 Identities = 80/99 80%, Positives = 86/99 86%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
            AFVLDADNLIPK                      KITFGEGSQYGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHYHTKGDVEIKEEHVMAGKEKA 140
                 +EGDAL+DT+EK+ YETKLV A  S +IIK+ S YHTKGDVEIKEEHV AGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  HGLFKLIESYLKGHPDAYN 159
              LFKLIE YLK HP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 98.0 bits 345,  Expect = 1e-22
 Identities = 61/148 41%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
            EGS    +  + D+V++   +Y  T+I+GD L   IE +  ET LV    +  GSI K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            + +HTKGD  + EE++    E+   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYL 151

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 97.2 bits 342,  Expect = 2e-22
 Identities = 61/148 41%, Positives = 89/148 60%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
            EGS    +  + D+V++   +Y  T+I+GD L   IE +  ET LV    +  GSI K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            + +HTKGD  + EE++     +   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 123. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 96.4 bits 339,  Expect = 4e-22
 Identities = 59/148 39%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            + +HTKGD  + EE++     +   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 95.8 bits 337,  Expect = 6e-22
 Identities = 59/148 39%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            + +HTKGD  + EE++     +   LFK IE+YL
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 165

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 94.6 bits 332,  Expect = 1e-21
 Identities = 60/148 40%, Positives = 88/148 59%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151
            + +HTKGD  + EE++     +   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 63.8 bits 212,  Expect = 8e-13
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 49.2 bits 160,  Expect = 6e-08
 Identities = 39/124 31%, Positives = 62/124 50%, Gaps = 10/124 8%
Query  24   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YAYTLIEGDALTDTIE--KVSYETKLVASGSGSIIKSISHYHTKGDVEIKEEHVMAGKEK 139
                +IEG  L   +   K +++   +      +   IS+ H   D +I EE V   K  
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH---DSDI-EEKVTPTKTS 136
Query  140  AHGLFKL--IESYL 151
               L  L  +E YL
Sbjct  137  QSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 37.0 bits 108,  Expect = 5e-05
 Identities = 17/24 70%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVL 25
            GV+T E++ TS IPP RLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.