The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK
YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q3T923 Fra a 1 160 1054 306.9 1.7e-85
Q256S7 Fra a 1 160 1052 306.4 2.5e-85
Q256S6 Fra a 1 160 1043 303.8 1.5e-84
Q256S2 Fra a 1 160 1034 301.2 8.7e-84
Q256S4 Fra a 1 159 1033 300.9 1.1e-83
Q2I6V8 Pru p 1.0101 160 893 260.9 1.2e-71
O24248 Pru av 1 160 872 254.9 7.6e-70
AAB01362 Mal d 1.0201 159 830 242.9 3.1e-66
AAD26545 Mal d 1.0202 159 830 242.9 3.1e-66
CAD32318 Mal d 1.0208 158 828 242.4 4.6e-66
AAD26548 Mal d 1.0204 159 826 241.8 6.8e-66
AAD13683 Mal d 1.0206 159 825 241.5 8.3e-66
AAK13030 Mal d 1.0207 159 824 241.2 1e-65
AAD26547 Mal d 1.0203 159 824 241.2 1e-65
AAD26558 Mal d 1.0205 159 822 240.6 1.5e-65
AAD26552 Mal d 1.0104 159 817 239.2 4.1e-65
O65200 Pyr c 1 159 815 238.6 6e-65
AAD29671 Mal d 1.0108 159 810 237.2 1.6e-64
CAA58646 Mal d 1.0101 159 805 235.8 4.4e-64
AAD26554 Mal d 1.0106 159 804 235.5 5.3e-64
AAD26546 Mal d 1.0103 159 801 234.6 9.7e-64
AAD26553 Mal d 1.0105 159 799 234.1 1.4e-63
AAK13029 Mal d 1.0109 159 794 232.6 3.9e-63
CAA96536 Mal d 1.0402 160 793 232.3 4.7e-63
CAA96535 Mal d 1.0401 160 793 232.3 4.7e-63
CAA96537 Mal d 1.0403 160 793 232.3 4.7e-63
AAD26555 Mal d 1.0107 159 790 231.5 8.5e-63
AAO25113 Mal d 1.0304 159 790 231.5 8.5e-63
CAA88833 Mal d 1.0102 159 785 230.1 2.3e-62
AAK13027 Mal d 1.0302 159 777 227.8 1.1e-61
O50001 Pru ar 1 160 769 225.5 5.5e-61
CAA96534 Mal d 1.0301 159 761 223.2 2.7e-60
AAK13028 Mal d 1.0303 159 757 222.1 5.9e-60
B6CQS9 Pru du 1.0101 160 753 220.9 1.3e-59
APD76154 Jug r 5.0101 160 733 215.2 6.9e-58
CAD10374 Cas s 1 160 710 208.6 6.6e-56
ACJ23864 Fag s 1.0101 160 706 207.5 1.4e-55
CAA96549 Cor a 1.0301 160 702 206.3 3.2e-55
AFN42528 Can s 5.0101 161 679 199.8 3.1e-53
ABZ81046 Que a 1.0301 160 677 199.2 4.5e-53
CAA54696.1 Bet v 1.0301 160 674 198.3 8.2e-53
AAG40329 Cor a 1.0402 161 658 193.8 2e-51
AUH28179 Que m 1.0101 160 655 192.9 3.5e-51
AAG40330 Cor a 1.0403 161 655 192.9 3.6e-51
AAG40331 Cor a 1.0404 161 655 192.9 3.6e-51
AAD48405 Cor a 1.0401 161 653 192.3 5.3e-51
Q39427 Bet v 1.0205 160 639 188.3 8.4e-50
ABZ81047 Que a 1.0401 160 633 186.6 2.8e-49
P43186 Bet v 1.0204 160 632 186.3 3.4e-49
CAB02217 Car b 1.0302 161 632 186.3 3.4e-49
CAA96548 Cor a 1.0201 160 631 186.0 4.1e-49
CAA04828.1 Bet v 1.0206 159 628 185.2 7.4e-49
CAA50325 Cor a 1.0103 160 625 184.3 1.3e-48
CAA54481 Bet v 1.0202 160 620 182.9 3.6e-48
P43184 Bet v 1.0203 160 619 182.6 4.4e-48
CAB02216 Car b 1.0301 161 619 182.6 4.5e-48
CAA54421 Bet v 1.0201 160 618 182.3 5.4e-48
CAA50327 Cor a 1.0101 160 614 181.2 1.2e-47
QOL10866 Que ac 1.0101 159 610 180.0 2.6e-47
Q08407 Cor a 1 159 607 179.2 4.7e-47
Q0Z8U9 Rub i 1.0101 137 606 178.9 4.8e-47
CAA07329.1 Bet v 1.0118 160 606 178.9 5.8e-47
CAA50328 Cor a 1.0102 160 604 178.3 8.6e-47
CAB02160 Bet v 1.0113 160 601 177.5 1.6e-46
QGS84240 Que i 1.0101 159 600 177.2 1.9e-46
CAA54487 Bet v 1.0106 160 597 176.3 3.5e-46
CAA33887 Bet v 1.0101 160 596 176.0 4.2e-46
CAA54483 Bet v 1.0103 160 596 176.0 4.2e-46
CAB02159 Bet v 1.0112 160 596 176.0 4.2e-46
CAM31908 Act c 8.0101 159 595 175.8 5.1e-46
CAA04827.1 Bet v 1.0116 159 595 175.8 5.1e-46
CAB02156 Bet v 1.0109 160 595 175.8 5.1e-46
CAB02161 Bet v 1.0114 160 594 175.5 6.3e-46
CAA54484 Bet v 1.0104 160 594 175.5 6.3e-46
AAB24432 Aln g 1 160 593 175.2 7.6e-46
CAB02207 Car b 1.0104 160 593 175.2 7.6e-46
ABZ81045 Que a 1.0201 159 591 174.6 1.1e-45
P38950 Car b 1 159 589 174.0 1.7e-45
ACF75030.1 Bet v 1.0207 150 588 173.8 1.9e-45
ABZ81041 Car b 1.0110 160 588 173.8 2.1e-45
CAA07323.1 Bet v 1.0117 160 588 173.8 2.1e-45
CAB02155 Bet v 1.0108 160 587 173.5 2.5e-45
ABZ81043 Car b 1.0112 160 587 173.5 2.5e-45
ABZ81042 Car b 1.0111 160 587 173.5 2.5e-45
P38948 Aln g 1 159 586 173.2 3e-45
CAB02206 Car b 1.0103 160 586 173.2 3.1e-45
CAA54482 Bet v 1.0102 160 586 173.2 3.1e-45
ABZ81040 Car b 1.0109 160 585 172.9 3.7e-45
CAB02157 Bet v 1.0110 160 585 172.9 3.7e-45
CAA54485 Bet v 1.0105 160 585 172.9 3.7e-45
CAB02209 Car b 1.0106 160 584 172.6 4.5e-45
CAB02208 Car b 1.0105 160 583 172.3 5.5e-45
ADK39021 Ost c 1.0101 160 583 172.3 5.5e-45
ABZ81044 Car b 1.0113 160 583 172.3 5.5e-45
CAA96547 Bet v 1.0115 160 580 171.5 1e-44
CAA50326 Cor a 1.0104 160 580 171.5 1e-44
CAB02158 Bet v 1.0111 160 579 171.2 1.2e-44
CAA54489 Bet v 1.0107 160 579 171.2 1.2e-44
CAB02213 Car b 1.0107 160 574 169.8 3.3e-44
CAA47357 Car b 1.0102 159 569 168.3 8.8e-44
CAB02215 Car b 1.0108 160 564 166.9 2.4e-43
P38949 Car b 1 159 556 164.6 1.2e-42
ABC41615.1 Bet v 1.0119 150 542 160.6 1.7e-41
CAM31909 Act d 8.0101 157 535 158.6 7.3e-41
CAA42646 Gly m 4 158 520 154.3 1.4e-39
AAQ91847 Ara h 8.0101 157 513 152.3 5.7e-39
NP_001275580 Sola l 4.0201 160 511 151.8 8.7e-39
CAA43637 Pha v 1 156 497 147.8 1.3e-37
AHC08073 Sola l 4.0101 160 496 147.5 1.7e-37
CAA43636 Pha v 1 155 494 146.9 2.4e-37
P25985 Pha v 1 155 490 145.8 5.3e-37
Q2VU97 Vig r 1.0101 155 455 135.8 5.5e-34
CAA75803 Lyc e 4.0101 178 455 135.7 6.5e-34
Q5ULZ4 Fra a 1.0101 100 449 134.2 1.1e-33
CAA67246 Pet c PR10 155 447 133.5 2.7e-33
EF436550 Ara h 8.0201 153 445 132.9 3.9e-33
P49372 Api g 1 154 425 127.2 2.1e-31
AAL76932 Dau c 1.0201 154 405 121.5 1.1e-29
P92918 Api g 1.0201 159 404 121.2 1.4e-29
CAB03716 Dau c 1.0104 154 389 116.9 2.6e-28
CAB06416 Dau c 1.0105 154 386 116.0 4.7e-28
AAB92255 Tar o RAP 157 385 115.7 5.9e-28
BAA13604 Dau c 1.0102 154 384 115.5 7e-28
AAB01092 Dau c 1.0101 168 382 114.9 1.2e-27
CAB03715 Dau c 1.0103 154 371 111.8 9.2e-27
P85126 Que a 1.0101 50 197 62.3 2.2e-12
Q9ZWP8 Vig r 6.0101 155 179 56.9 3.1e-10
Q9S8Q4 Cas s 1 24 94 33.1 0.00067
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 306.9 bits 1054,  Expect = 2e-85
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 2. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 306.4 bits 1052,  Expect = 2e-85
 Identities = 158/160 98%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQA+KCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGT+IKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 3. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 303.8 bits 1043,  Expect = 1e-84
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG YTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQA+KCAEILEGDGGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGT+IKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 4. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 301.2 bits 1034,  Expect = 9e-84
 Identities = 156/160 97%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSHYGYVKHKIHSIDK NHTYSYSLIEGDALS+NIEKIDYETKLVSAPHGGT+IKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA+HLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 5. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 300.9 bits 1033,  Expect = 1e-83
 Identities = 158/159 99%, Positives = 159/159 100%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG T+IKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 6. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 260.9 bits 893,  Expect = 1e-71
 Identities = 132/160 82%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI SIDKENH+YSY+LIEGDAL DN+EKI YETKLV++P GG++IK+TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 7. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 254.9 bits 872,  Expect = 8e-70
 Identities = 129/160 80%, Positives = 148/160 92%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI SIDKEN++YSY+LIEGDAL D +EKI YETKLV++P GG++IK+TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+VEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 8. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 242.9 bits 830,  Expect = 3e-66
 Identities = 125/159 78%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 9. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 242.9 bits 830,  Expect = 3e-66
 Identities = 125/159 78%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 242.4 bits 828,  Expect = 5e-66
 Identities = 125/158 79%, Positives = 141/158 89%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GVYTYENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            GS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 119
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            HTKGDVEI EEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 11. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 241.8 bits 826,  Expect = 7e-66
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKL+ A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLM-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 241.5 bits 825,  Expect = 8e-66
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFK FVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 241.2 bits 824,  Expect = 1e-65
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 241.2 bits 824,  Expect = 1e-65
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKA  LFKLIE +LK HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 240.6 bits 822,  Expect = 2e-65
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV A   G++IK+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 239.2 bits 817,  Expect = 4e-65
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 17. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 238.6 bits 815,  Expect = 6e-65
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG+YT+ENEFTS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH++ SID+ +++Y+Y+LIEGDAL+D IEKI YE KLV A   G+ IK+ S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLV-ASGSGSTIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD+EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 237.2 bits 810,  Expect = 2e-64
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 235.8 bits 805,  Expect = 4e-64
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVK GKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 20. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 235.5 bits 804,  Expect = 5e-64
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IE I YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 234.6 bits 801,  Expect = 1e-63
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 234.1 bits 799,  Expect = 1e-63
 Identities = 123/159 77%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 232.6 bits 794,  Expect = 4e-63
 Identities = 122/159 76%, Positives = 139/159 87%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVK GKEKA  LFKLIE YLKDHP  YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 232.3 bits 793,  Expect = 5e-63
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE EFTS IPAP+LFKAF+LD DNLIPKIAPQA+K  +I+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P GG++IKT S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 232.3 bits 793,  Expect = 5e-63
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P GG++IKTTS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 232.3 bits 793,  Expect = 5e-63
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE EFTS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P GG++IKTTS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            Y  KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 231.5 bits 790,  Expect = 9e-63
 Identities = 121/159 76%, Positives = 139/159 87%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG++EIKEEHVKAGK KA  LFKLIE YLK HP  YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 231.5 bits 790,  Expect = 9e-63
 Identities = 124/159 77%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G+VIK+TS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +HP  YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 230.1 bits 785,  Expect = 2e-62
 Identities = 120/159 75%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGAT-IKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YH KG++EIKEEHVK GKEK   LFKLIE YLK HP  YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 227.8 bits 777,  Expect = 1e-61
 Identities = 122/159 76%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVKH+I  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV+A   G+VIK+TS 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAG-SGSVIKSTSH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 31. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 225.5 bits 769,  Expect = 6e-61
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE EFTS IP  KLFKAF+LDADNLIPK+AP AVK  EILEGDGG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+Y YVKH++  IDK+N +YSY+LIEGDALSD IE I Y+ KLV++P GG+++KTTS 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +P  YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 32. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 223.2 bits 761,  Expect = 3e-60
 Identities = 121/159 76%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G+VIK+TS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTK DVEIKEEHVKAGKEKASHLFKLIE YL  H   YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 33. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 222.1 bits 757,  Expect = 6e-60
 Identities = 120/159 75%, Positives = 131/159 82%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE EFTS IP  +L+ AFVLDADNLIPKIAPQAVK  EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVKHKI  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV A   G+VIK+ S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSISH 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 34. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 220.9 bits 753,  Expect = 1e-59
 Identities = 114/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG++TY +E TS IP P+LFKA+VL+AD LIPKIAPQ+VK AEI+EGDGG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSHY YVKH+I  +DK+N  Y+YSL+EGDALSD +EKI YE KLV++  GG+VIK+TS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGDVEIKEE VKAGKEKA+ LFKLIE YL  +P  YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 35. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 215.2 bits 733,  Expect = 7e-58
 Identities = 110/160 68%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE E TS IP  +LFKAFVLDADNLIPK+ PQAVK +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL+D IEKI YETK+V++  GG+++K+ S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YH+KGD EIKEE VK GKEKAS LFK +EGYL  HP  YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 208.6 bits 710,  Expect = 7e-56
 Identities = 106/160 66%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+ENE TS IP  +LFKAFVLDADNLIPK+AP+A+K AEI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS++ YVKH+I  ID+ N TY YS+IEGD +++ +EKI YE K+V++P GG+++K TSK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ EIKEE V AGKEKA+ LFK +E YL  H   YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 207.5 bits 706,  Expect = 1e-55
 Identities = 104/160 65%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+E T+ I   +LFKAFVLDADNLIPK+APQA+K +EI+EG GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+S+ +EKI YE KLV++P GG+++K+TSK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P+ Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 206.3 bits 702,  Expect = 3e-55
 Identities = 101/160 63%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IP  +LFK FVLD+DNLIPK+AP+A+K  EI+EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + Y+K+K+  ID+ N +Y YS+IEGDALSD +EKI+YE K+V++PHGG+++K+ SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHT GD E+K+E++KAGKEKAS LFK +EGYL  H   YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 199.8 bits 679,  Expect = 3e-53
 Identities = 103/160 64%, Positives = 131/160 81%, Gaps = 1/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS I   +LFKAFVLD DNL+PKIAPQAV+  EILEG+GG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDN-IEKIDYETKLVSAPHGGTVIKTTS 119
            +G  + YVKHKI +IDKE+ TYSYS+IEGDAL  N +EKI +E+KLV++  GG VIKT S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            KY++ GD ++ EE VK G+++A++++K +E YLKDHP  YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 40. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 199.2 bits 677,  Expect = 5e-53
 Identities = 98/159 61%, Positives = 127/159 79%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P GG+++K+TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 41. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 198.3 bits 674,  Expect = 8e-53
 Identities = 98/160 61%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS I   +LFK+FVLDADNLIPK+AP+ V  AE +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSH+ Y+KH++  ID  N  Y YS+IEG  L D +EKI YE K+V+AP GG+++K TSK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD+ + EE +KAGKEK + LFK +E YL  HP+ YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 193.8 bits 658,  Expect = 2e-51
 Identities = 99/159 62%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV++YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGG-TVIKTTS 119
            EGS + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHGG +++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 43. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 192.9 bits 655,  Expect = 4e-51
 Identities = 95/159 59%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV  YE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSH  + KH+I  ID EN T+S+S+IEGDAL D +E +  ETK+V++P GG+++K+T K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 44. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 192.9 bits 655,  Expect = 4e-51
 Identities = 99/159 62%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGG-TVIKTTS 119
            EGS + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHGG +++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 192.9 bits 655,  Expect = 4e-51
 Identities = 98/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV++YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGG-TVIKTTS 119
            EG+ + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHGG +++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 46. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 192.3 bits 653,  Expect = 5e-51
 Identities = 98/159 61%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGG-TVIKTTS 119
            EG+ + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHGG +++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 188.3 bits 639,  Expect = 8e-50
 Identities = 95/160 59%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E KLV+ P GG+++K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K EH+KA KEKA  L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 186.6 bits 633,  Expect = 3e-49
 Identities = 93/159 58%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P GG++ K+TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 186.3 bits 632,  Expect = 3e-49
 Identities = 93/160 58%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 186.3 bits 632,  Expect = 3e-49
 Identities = 93/160 58%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD +NLIPK+APQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP GG+++K TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 51. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 186.0 bits 631,  Expect = 4e-49
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD +NLIPK+APQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP GG+++K ++K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+  EH+K GKEK   LF+ +E YL  H   YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 185.2 bits 628,  Expect = 7e-49
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE+E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            GS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E KLV+ P GG+++K ++KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            HTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 53. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 184.3 bits 625,  Expect = 1e-48
 Identities = 90/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 182.9 bits 620,  Expect = 4e-48
 Identities = 91/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 182.6 bits 619,  Expect = 4e-48
 Identities = 91/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 182.6 bits 619,  Expect = 4e-48
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP GG+++K TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 182.3 bits 618,  Expect = 5e-48
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 181.2 bits 614,  Expect = 1e-47
 Identities = 89/160 55%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 59. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 180.0 bits 610,  Expect = 3e-47
 Identities = 91/159 57%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVY YE++ TS IP  +LFKAFVLD+DNLI K+ P+AVK  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E S   Y KH+I ++D EN +YS+S+IEG+AL+D I  I  E K+V++P GG+++K+T+K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HP  YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 60. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 179.2 bits 607,  Expect = 5e-47
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            GS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 61. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 178.9 bits 606,  Expect = 5e-47
 Identities = 95/137 69%, Positives = 111/137 81%, Gaps = 1/137 0%
Query  10   FTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVK 69
            +TS IP PKLFKAFVLDADNLIPKIAPQAVK  EI+EGDGG GT+KKI +GEG+ + YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDVEI 129
            HKI  +DK N  YSYS+ EGDAL D IEKI YE KLV++  G ++IKTTS YH KG  EI
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEI 119
Query  130  KEEHVKAGKEKASHLFKL 147
            KEE+VK GKE+A+ LFK+
Sbjct  120  KEEQVKDGKERAAGLFKI 137

Sequence Alignment: 62. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 178.9 bits 606,  Expect = 6e-47
 Identities = 88/160 55%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E KLV+ P GG++++ ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 178.3 bits 604,  Expect = 9e-47
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP GG+++K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 177.5 bits 601,  Expect = 2e-46
 Identities = 86/160 53%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 177.2 bits 600,  Expect = 2e-46
 Identities = 90/158 56%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQA+K  E +EG+GGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E S + Y KH+I ++D EN TYS+S+IEGDAL+D +  +  E K+V++P GG++ K+T+K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            Y+TKGD ++KEE+++A  EK + L K +E YL  HP  Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 66. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 176.3 bits 597,  Expect = 3e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+GG+++K  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 176.0 bits 596,  Expect = 4e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 176.0 bits 596,  Expect = 4e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+GG+++K  +K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 176.0 bits 596,  Expect = 4e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 175.8 bits 595,  Expect = 5e-46
 Identities = 84/156 53%, Positives = 116/156 74%, Gaps = 0/156 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV TY+ E  S +P  KL+KAF+LD D L+PK+ P+A+KC +ILEGDG  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGSH+  VK+++ +IDK+N TYSY++IEGD L++  E I Y  K+V+ P GG++ K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +P
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 71. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 175.8 bits 595,  Expect = 5e-46
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            G  + YVK ++  +D  N  YSYSLIEG  + D +EKI  E K+V+ P GG+++K ++KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            HTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 72. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 175.8 bits 595,  Expect = 5e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 175.5 bits 594,  Expect = 6e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 175.5 bits 594,  Expect = 6e-46
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+GG+++K  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 175.2 bits 593,  Expect = 8e-46
 Identities = 87/160 54%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFKAF+LD D L+PK+AP+AV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + YVK ++  +D+ N  YS+S+IEG A+ D +EK+  E K+V+AP GG+++K ++K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +HTKGD EI  E++K  KEKA  L+K +E YL  H   YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 175.2 bits 593,  Expect = 8e-46
 Identities = 83/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L DN+EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 77. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 174.6 bits 591,  Expect = 1e-45
 Identities = 88/158 55%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E S + Y KH+I ++D EN TYS+S+IEGDAL+  +E +  E K V++P GG+++K+T+K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HP  Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 78. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 174.0 bits 589,  Expect = 2e-45
 Identities = 85/159 53%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            GS   YVK ++  ID  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            H KG  E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 79. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 173.8 bits 588,  Expect = 2e-45
 Identities = 86/149 57%, Positives = 113/149 75%, Gaps = 0/149 0%
Query  4    YTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGS 63
            + YE+E TS IPA +LFKAF+L+ DNLIPK+APQA+   E +EG+GGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   HYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHT 123
             + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+++K ++KYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            KGD E+K EH+KA KEK   L++ +E YL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 80. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 173.8 bits 588,  Expect = 2e-45
 Identities = 83/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+V+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 81. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 173.8 bits 588,  Expect = 2e-45
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 82. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 173.5 bits 587,  Expect = 3e-45
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 83. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 173.5 bits 587,  Expect = 3e-45
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 173.5 bits 587,  Expect = 3e-45
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 85. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 173.2 bits 586,  Expect = 3e-45
 Identities = 86/159 54%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFKAF+LD D L+PK+AP+AV   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            GS + YVK ++  +D+ N  YS+S+IEG A+ D +EK+  E K+V+AP GG+++K ++K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            HTKGD EI  E++K  KEKA  L+K +E YL  H   YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 86. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 173.2 bits 586,  Expect = 3e-45
 Identities = 82/160 51%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 87. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 173.2 bits 586,  Expect = 3e-45
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 88. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 172.9 bits 585,  Expect = 4e-45
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 89. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 172.9 bits 585,  Expect = 4e-45
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 90. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 172.9 bits 585,  Expect = 4e-45
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+L+ DNLIPK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 172.6 bits 584,  Expect = 5e-45
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 172.3 bits 583,  Expect = 6e-45
 Identities = 82/160 51%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 93. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 172.3 bits 583,  Expect = 6e-45
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 172.3 bits 583,  Expect = 6e-45
 Identities = 82/160 51%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + +VK ++  +D  N  YSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 171.5 bits 580,  Expect = 1e-44
 Identities = 84/160 52%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +  +N  YSYS+IEG  + D +EKI  E K+V+ P G +++K ++K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 96. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 171.5 bits 580,  Expect = 1e-44
 Identities = 86/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S I A +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP GG+ +K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 97. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 171.2 bits 579,  Expect = 1e-44
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
             G  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 98. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 171.2 bits 579,  Expect = 1e-44
 Identities = 84/160 52%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA ++FKAF+LD D L+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 99. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 169.8 bits 574,  Expect = 3e-44
 Identities = 81/160 50%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E K+V+AP GG+++K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 168.3 bits 569,  Expect = 9e-44
 Identities = 80/159 50%, Positives = 112/159 70%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            GS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            H KG  E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 166.9 bits 564,  Expect = 2e-43
 Identities = 79/160 49%, Positives = 111/160 69%, Gaps = 0/160 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S +PA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E  +V+AP GG+++K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 164.6 bits 556,  Expect = 1e-42
 Identities = 78/159 49%, Positives = 110/159 69%, Gaps = 0/159 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQ +   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
            G  + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            H KG  E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 160.6 bits 542,  Expect = 2e-41
 Identities = 78/149 52%, Positives = 106/149 71%, Gaps = 0/149 0%
Query  4    YTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGS 63
            + YE E TS IPA +LFKAF+LD DNL PK+APQA+   + +EG+GGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   HYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHT 123
             + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG ++K ++KYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            KG+ E+K E+VKA KE    L++ +E YL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 158.6 bits 535,  Expect = 7e-41
 Identities = 85/155 54%, Positives = 105/155 67%, Gaps = 1/155 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  TY+ E  S I A K+FKAFVLD D +IPK  P+A+   + LEGDGG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS +  VKH+I  +DKEN TYSYS+IEG AL D  E I Y  K+V+ P GG + K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
            Y  K D ++ EE +KAGKE+AS +FK +E YL  +P
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 154.3 bits 520,  Expect = 1e-39
 Identities = 85/158 53%, Positives = 109/158 68%, Gaps = 2/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E  S +    L+KA+V DADN+IPK A  + K  E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E     +V HKI SID+ N  YSYS++ G AL D  EKI +++KLV+ P+GG+  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160
            Y TKGD E  ++ +K GK KA  LFK IE YL  HP +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 152.3 bits 513,  Expect = 6e-39
 Identities = 80/157 50%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E TS +P  KL+ A + DAD++ PKI    VK  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+GG++ K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 151.8 bits 511,  Expect = 9e-39
 Identities = 83/159 52%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+ +E T+ I   +LFK +VLD D+L+PK+  + VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG    Y+KHKIH ID +N    YSLIEGD L D +E I Y+ K+ +A  GG V KTT++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 147.8 bits 497,  Expect = 1e-37
 Identities = 75/156 48%, Positives = 104/156 66%, Gaps = 0/156 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E     +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 147.5 bits 496,  Expect = 2e-37
 Identities = 79/159 49%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +GG V KTT++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 146.9 bits 494,  Expect = 2e-37
 Identities = 77/155 49%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            M V+T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E     +V HKI  ID+ N  YSYS++ G AL D  EKI  ++KL   P+GG+V+K + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 145.8 bits 490,  Expect = 5e-37
 Identities = 74/155 47%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
                 +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 135.8 bits 455,  Expect = 5e-34
 Identities = 73/155 47%, Positives = 101/155 65%, Gaps = 1/155 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            M V+T++++ TS +    L+ A+  DADN+IPK A  + +  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E     +V HKI S+D+ N  YSYS++ G AL D  EKI  +TK+     GG++IK T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
            YH KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 135.7 bits 455,  Expect = 6e-34
 Identities = 72/146 49%, Positives = 95/146 65%, Gaps = 0/146 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +GG V KTT++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFK 146
            YHTKGD  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 114. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 134.2 bits 449,  Expect = 1e-33
 Identities = 91/100 91%, Positives = 96/100 96%, Gaps = 39/100 39%
Query  22   AFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
            AFVLDADNLIPK                      KITFGEGS+YGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKA 141
                 +EGDALSD +EKIDYETKLVSAP   T+IKTTSKYHTKGDVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  SHLFKLIEGYLKDHPSEYN 160
            +HLFKLIEGYLKDHPSEYN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 133.5 bits 447,  Expect = 3e-33
 Identities = 69/152 45%, Positives = 100/152 65%, Gaps = 0/152 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV   E   TS +PA KLFKA+ LD D L+P++ P A+K  EILEGDGG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            + S Y  +K+KI +IDKE  T+SYS+I+GD L   I+ I+    +V    GG    +T+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152

Sequence Alignment: 116. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 132.9 bits 445,  Expect = 4e-33
 Identities = 70/150 46%, Positives = 103/150 68%, Gaps = 2/150 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E E TS +P  KLFKA V+D D L PK+ P A++  EI+EG+GGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            E     YV HKI +ID+  +TY Y++  G  + + +EK+ ++TKL +A  GG+ IK +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAAD-GGSKIKVSVT 118
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            +HTKGD  + +E  +  K+K+  +FK IEGY+
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYV 150

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 127.2 bits 425,  Expect = 2e-31
 Identities = 68/151 45%, Positives = 98/151 64%, Gaps = 1/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            +G     +  +I  ++KE  T+ YS+I+GD L   IE I+    LV    GG++ KTT+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 121.5 bits 405,  Expect = 1e-29
 Identities = 63/150 42%, Positives = 95/150 63%, Gaps = 3/150 2%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV   E E  S + A K+++ F+LD D + PK+ PQ +K  EILEGDGG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAP-HGGTVIKTTS 119
            E + Y  +K+K+  IDK    Y+Y+ I GD L + +E +    ++V  P  GG ++K T+
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESV--VNQFVVVPTDGGCIVKNTT 118
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
             Y+TKGD  + E+ VK   EK++  FK +E YL
Sbjct  119  IYNTKGDAVLPEDKVKEATEKSALAFKAVEAYL 151

Sequence Alignment: 119. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 121.2 bits 404,  Expect = 1e-29
 Identities = 64/150 42%, Positives = 94/150 62%, Gaps = 3/150 2%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV     E  S + A K+++ F+LD D + PK+ PQ +K  EILEGDGG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAP-HGGTVIKTTS 119
            E + Y  +K+K+  IDK    Y+Y+ I GD L D +E +  E  +V  P  GG ++K T+
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNE--FVVVPTDGGCIVKNTT 118
Query  120  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
             Y+TKGD  + E+ +K   EK++  FK +E YL
Sbjct  119  IYNTKGDAVLPEDKIKEATEKSALAFKAVEAYL 151

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 116.9 bits 389,  Expect = 3e-28
 Identities = 67/149 44%, Positives = 95/149 63%, Gaps = 5/149 3%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAP--HGGTVIKTT 118
            EGS    +  +  +++KE  TY  ++I+GD L   IE I  ET LV  P   GG++ KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  119  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            + +HTKGD  + EE++K   E+ + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYL 151

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 116.0 bits 386,  Expect = 5e-28
 Identities = 67/149 44%, Positives = 94/149 63%, Gaps = 5/149 3%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAP--HGGTVIKTT 118
            EGS    +  +  +++KE  TY  ++I+GD L   IE I  ET LV  P   GG++ KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  119  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 122. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 115.7 bits 385,  Expect = 6e-28
 Identities = 60/150 40%, Positives = 87/150 58%, Gaps = 0/150 0%
Query  7    ENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYG 66
            E E TS +    +FKAFV+D D + PK  P+  K  + +EGDGG GTIK IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGD 126
              KHK+ +ID  N + SY++ EGD L   IE   +  K++ +  GG+V K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  VEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156
             ++ +E+V   KE     FK IE Y+  HP
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 115.5 bits 384,  Expect = 7e-28
 Identities = 62/151 41%, Positives = 93/151 61%, Gaps = 1/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS    +  +  +++KE  TY  ++I+GD L + IE I+    +V    GG++ KTT+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 114.9 bits 382,  Expect = 1e-27
 Identities = 62/151 41%, Positives = 93/151 61%, Gaps = 1/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS    +  +  +++KE  TY  ++I+GD L + IE I+    +V    GG++ KTT+ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 165

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 111.8 bits 371,  Expect = 9e-27
 Identities = 61/151 40%, Positives = 91/151 60%, Gaps = 1/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
            EGS    +  +  +++KE  +Y  ++I+GD L   IE I+    +V    GG++ KTT+ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 62.3 bits 197,  Expect = 2e-12
 Identities = 29/50 58%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGP 51
            GV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 56.9 bits 179,  Expect = 3e-10
 Identities = 38/130 29%, Positives = 59/130 45%, Gaps = 3/130 2%
Query  24   VLDAD--NLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
            VL  D   ++PK+ P+ VK  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKA 141
                +IEG  L+  +       KL       T++     Y    D+E K    K  +   
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
Query  142  SHLFKLIEGYLKD 154
             +L +L E YL +
Sbjct  141  MYLRRL-ERYLSN 152

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.1 bits 94,  Expect = 0.0007
 Identities = 15/24 62%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVL 25
            GV+T+E++ TS IP  +LFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.