The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY
HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q256S4 Fra a 1 159 1046 318.7 4.7e-89
Q3T923 Fra a 1 160 1033 314.8 7e-88
Q256S7 Fra a 1 160 1033 314.8 7e-88
Q256S6 Fra a 1 160 1024 312.1 4.5e-87
Q256S2 Fra a 1 160 1015 309.4 2.9e-86
Q2I6V8 Pru p 1.0101 160 874 267.2 1.5e-73
O24248 Pru av 1 160 853 260.9 1.2e-71
AAB01362 Mal d 1.0201 159 840 257.0 1.8e-70
AAD26545 Mal d 1.0202 159 840 257.0 1.8e-70
CAD32318 Mal d 1.0208 158 838 256.4 2.7e-70
AAD26548 Mal d 1.0204 159 836 255.8 4.1e-70
AAD13683 Mal d 1.0206 159 835 255.5 5e-70
AAK13030 Mal d 1.0207 159 834 255.2 6.2e-70
AAD26547 Mal d 1.0203 159 834 255.2 6.2e-70
AAD26558 Mal d 1.0205 159 832 254.6 9.4e-70
AAD26552 Mal d 1.0104 159 825 252.5 4e-69
O65200 Pyr c 1 159 823 251.9 6.1e-69
AAD29671 Mal d 1.0108 159 818 250.4 1.7e-68
CAA58646 Mal d 1.0101 159 813 248.9 4.9e-68
AAD26554 Mal d 1.0106 159 812 248.6 6e-68
AAD26546 Mal d 1.0103 159 809 247.7 1.1e-67
AAD26553 Mal d 1.0105 159 807 247.1 1.7e-67
AAK13029 Mal d 1.0109 159 802 245.6 4.8e-67
AAD26555 Mal d 1.0107 159 798 244.4 1.1e-66
AAO25113 Mal d 1.0304 159 798 244.4 1.1e-66
CAA88833 Mal d 1.0102 159 791 242.3 4.7e-66
AAK13027 Mal d 1.0302 159 787 241.1 1.1e-65
CAA96535 Mal d 1.0401 160 774 237.2 1.6e-64
CAA96536 Mal d 1.0402 160 774 237.2 1.6e-64
CAA96537 Mal d 1.0403 160 774 237.2 1.6e-64
CAA96534 Mal d 1.0301 159 769 235.7 4.5e-64
AAK13028 Mal d 1.0303 159 765 234.5 1e-63
O50001 Pru ar 1 160 750 230.0 2.4e-62
B6CQS9 Pru du 1.0101 160 739 226.7 2.3e-61
APD76154 Jug r 5.0101 160 714 219.2 4.2e-59
CAD10374 Cas s 1 160 691 212.3 4.9e-57
ACJ23864 Fag s 1.0101 160 687 211.1 1.1e-56
CAA96549 Cor a 1.0301 160 683 210.0 2.6e-56
AFN42528 Can s 5.0101 161 661 203.4 2.5e-54
ABZ81046 Que a 1.0301 160 658 202.5 4.7e-54
CAA54696.1 Bet v 1.0301 160 655 201.6 8.7e-54
AAG40329 Cor a 1.0402 161 649 199.8 3.1e-53
AAG40330 Cor a 1.0403 161 646 198.9 5.7e-53
AAG40331 Cor a 1.0404 161 646 198.9 5.7e-53
AAD48405 Cor a 1.0401 161 644 198.3 8.7e-53
AUH28179 Que m 1.0101 160 636 195.9 4.5e-52
Q39427 Bet v 1.0205 160 620 191.1 1.3e-50
Q0Z8U9 Rub i 1.0101 137 619 190.8 1.3e-50
ABZ81047 Que a 1.0401 160 614 189.3 4.4e-50
P43186 Bet v 1.0204 160 613 189.0 5.4e-50
CAB02217 Car b 1.0302 161 613 189.0 5.4e-50
CAA96548 Cor a 1.0201 160 612 188.7 6.6e-50
CAA04828.1 Bet v 1.0206 159 609 187.8 1.2e-49
CAA50325 Cor a 1.0103 160 606 186.9 2.3e-49
CAA54481 Bet v 1.0202 160 601 185.4 6.5e-49
P43184 Bet v 1.0203 160 600 185.1 8e-49
CAB02216 Car b 1.0301 161 600 185.1 8.1e-49
CAA54421 Bet v 1.0201 160 599 184.8 9.8e-49
CAA50327 Cor a 1.0101 160 595 183.6 2.3e-48
QOL10866 Que ac 1.0101 159 591 182.4 5.1e-48
Q08407 Cor a 1 159 588 181.5 9.6e-48
CAA07329.1 Bet v 1.0118 160 587 181.2 1.2e-47
CAA50328 Cor a 1.0102 160 585 180.6 1.8e-47
CAB02160 Bet v 1.0113 160 582 179.7 3.4e-47
QGS84240 Que i 1.0101 159 581 179.4 4.1e-47
CAA54487 Bet v 1.0106 160 578 178.5 7.7e-47
CAA33887 Bet v 1.0101 160 577 178.2 9.5e-47
CAA54483 Bet v 1.0103 160 577 178.2 9.5e-47
CAB02159 Bet v 1.0112 160 577 178.2 9.5e-47
CAM31908 Act c 8.0101 159 576 177.9 1.2e-46
CAA04827.1 Bet v 1.0116 159 576 177.9 1.2e-46
CAB02156 Bet v 1.0109 160 576 177.9 1.2e-46
CAB02161 Bet v 1.0114 160 575 177.6 1.4e-46
CAA54484 Bet v 1.0104 160 575 177.6 1.4e-46
AAB24432 Aln g 1 160 574 177.3 1.8e-46
CAB02207 Car b 1.0104 160 574 177.3 1.8e-46
ABZ81045 Que a 1.0201 159 572 176.7 2.7e-46
CAA96547 Bet v 1.0115 160 572 176.7 2.7e-46
P38950 Car b 1 159 570 176.1 4e-46
ACF75030.1 Bet v 1.0207 150 569 175.8 4.6e-46
ABZ81042 Car b 1.0111 160 568 175.5 6.2e-46
ABZ81043 Car b 1.0112 160 568 175.5 6.2e-46
P38948 Aln g 1 159 567 175.2 7.5e-46
CAB02206 Car b 1.0103 160 567 175.2 7.6e-46
ABZ81041 Car b 1.0110 160 567 175.2 7.6e-46
CAA07323.1 Bet v 1.0117 160 567 175.2 7.6e-46
ABZ81040 Car b 1.0109 160 566 174.9 9.3e-46
CAB02155 Bet v 1.0108 160 566 174.9 9.3e-46
CAA54482 Bet v 1.0102 160 565 174.6 1.1e-45
CAB02209 Car b 1.0106 160 565 174.6 1.1e-45
CAB02208 Car b 1.0105 160 564 174.3 1.4e-45
ADK39021 Ost c 1.0101 160 564 174.3 1.4e-45
CAA54485 Bet v 1.0105 160 564 174.3 1.4e-45
CAB02157 Bet v 1.0110 160 564 174.3 1.4e-45
ABZ81044 Car b 1.0113 160 564 174.3 1.4e-45
CAA50326 Cor a 1.0104 160 559 172.8 4e-45
CAB02158 Bet v 1.0111 160 558 172.5 4.9e-45
CAA54489 Bet v 1.0107 160 558 172.5 4.9e-45
CAB02213 Car b 1.0107 160 555 171.6 9.2e-45
CAA47357 Car b 1.0102 159 550 170.1 2.6e-44
CAB02215 Car b 1.0108 160 545 168.6 7.3e-44
P38949 Car b 1 159 537 166.2 3.8e-43
ABC41615.1 Bet v 1.0119 150 523 162.0 6.5e-42
CAM31909 Act d 8.0101 157 516 159.9 2.9e-41
CAA42646 Gly m 4 158 499 154.8 1e-39
AAQ91847 Ara h 8.0101 157 494 153.3 2.8e-39
NP_001275580 Sola l 4.0201 160 490 152.1 6.7e-39
CAA43637 Pha v 1 156 478 148.5 7.8e-38
AHC08073 Sola l 4.0101 160 475 147.6 1.5e-37
CAA43636 Pha v 1 155 473 147.0 2.2e-37
P25985 Pha v 1 155 471 146.4 3.3e-37
EF436550 Ara h 8.0201 153 447 139.3 4.8e-35
Q5ULZ4 Fra a 1.0101 100 438 136.7 1.8e-34
Q2VU97 Vig r 1.0101 155 440 137.1 2.1e-34
CAA75803 Lyc e 4.0101 178 434 135.3 8.6e-34
CAA67246 Pet c PR10 155 433 135.1 8.9e-34
P49372 Api g 1 154 413 129.1 5.6e-32
P92918 Api g 1.0201 159 407 127.3 2e-31
AAL76932 Dau c 1.0201 154 405 126.7 3e-31
CAB03716 Dau c 1.0104 154 379 118.9 6.6e-29
CAB06416 Dau c 1.0105 154 376 118.0 1.2e-28
BAA13604 Dau c 1.0102 154 373 117.1 2.3e-28
AAB92255 Tar o RAP 157 373 117.1 2.3e-28
AAB01092 Dau c 1.0101 168 371 116.4 3.8e-28
CAB03715 Dau c 1.0103 154 360 113.2 3.4e-27
P85126 Que a 1.0101 50 197 64.7 4.2e-13
Q9ZWP8 Vig r 6.0101 155 170 56.2 4.7e-10
Q9S8Q4 Cas s 1 24 94 34.1 0.00033
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 318.7 bits 1046,  Expect = 5e-89
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 2. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 314.8 bits 1033,  Expect = 7e-88
 Identities = 158/159 99%, Positives = 159/159 100%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG T+IKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 3. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 314.8 bits 1033,  Expect = 7e-88
 Identities = 158/159 99%, Positives = 159/159 100%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQA+KCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG TIIKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 4. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 312.1 bits 1024,  Expect = 5e-87
 Identities = 157/159 98%, Positives = 158/159 99%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG YTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQA+KCAEILEGDGGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG TIIKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 5. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 309.4 bits 1015,  Expect = 3e-86
 Identities = 156/159 98%, Positives = 158/159 99%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSHYGYVKHKIHSIDK NHTYSYSLIEGDALS+NIEKIDYETKLVSAPHG TIIKTTSK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEEHVKAGKEKA+HLFKLIEGYLKDHPSEYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 6. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 267.2 bits 874,  Expect = 2e-73
 Identities = 132/159 83%, Positives = 148/159 93%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS+YGYVKHKI SIDKENH+YSY+LIEGDAL DN+EKI YETKLV++P G +IIK+TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 7. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 260.9 bits 853,  Expect = 1e-71
 Identities = 129/159 81%, Positives = 147/159 92%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS+IP P+LFKAFVLDADNL+PKIAPQA+K +EILEGDGGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS+YGYVKHKI SIDKEN++YSY+LIEGDAL D +EKI YETKLV++P G +IIK+TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+VEIKEEHVKAGKEKAS+LFKLIE YLK HP  YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 8. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 257.0 bits 840,  Expect = 2e-70
 Identities = 125/159 78%, Positives = 143/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 9. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 257.0 bits 840,  Expect = 2e-70
 Identities = 125/159 78%, Positives = 143/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 256.4 bits 838,  Expect = 3e-70
 Identities = 125/158 79%, Positives = 142/158 89%, Gaps = 0/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GVYTYENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKYH 121
            GS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S YH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            TKGDVEI EEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 11. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 255.8 bits 836,  Expect = 4e-70
 Identities = 124/159 77%, Positives = 143/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKL+++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 255.5 bits 835,  Expect = 5e-70
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFK FVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 255.2 bits 834,  Expect = 6e-70
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 255.2 bits 834,  Expect = 6e-70
 Identities = 124/159 77%, Positives = 143/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE +LK HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 254.6 bits 832,  Expect = 9e-70
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEGDGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKHKI S+D+ N++Y+Y+LIEGDAL+D IEK+ YETKLV++  G+IIK+ S Y
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 252.5 bits 825,  Expect = 4e-69
 Identities = 123/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 17. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 251.9 bits 823,  Expect = 6e-69
 Identities = 121/159 76%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG+YT+ENEFTS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH++ SID+ +++Y+Y+LIEGDAL+D IEKI YE KLV++  G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGD+EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 250.4 bits 818,  Expect = 2e-68
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 248.9 bits 813,  Expect = 5e-68
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVK GKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 20. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 248.6 bits 812,  Expect = 6e-68
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IE I YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 247.7 bits 809,  Expect = 1e-67
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLK HP  YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 247.1 bits 807,  Expect = 2e-67
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 245.6 bits 802,  Expect = 5e-67
 Identities = 121/159 76%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVK GKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 244.4 bits 798,  Expect = 1e-66
 Identities = 120/159 75%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKG++EIKEEHVKAGK KA  LFKLIE YLK HP  YN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 244.4 bits 798,  Expect = 1e-66
 Identities = 122/159 76%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV++  G++IK+TS Y
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIE YL +HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 26. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 242.3 bits 791,  Expect = 5e-66
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVYT+ENEFTS+IP  +LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G  IK+ S Y
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            H KG++EIKEEHVK GKEK   LFKLIE YLK HP  YN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 27. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 241.1 bits 787,  Expect = 1e-65
 Identities = 121/159 76%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS Y YVKH+I  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV+A  G++IK+TS Y
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 237.2 bits 774,  Expect = 2e-64
 Identities = 117/159 73%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P G +IIKTTS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 237.2 bits 774,  Expect = 2e-64
 Identities = 116/159 72%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE EFTS IPAP+LFKAF+LD DNLIPKIAPQA+K  +I+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P G +IIKT S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 237.2 bits 774,  Expect = 2e-64
 Identities = 117/159 73%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE EFTS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P G +IIKTTS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            Y  KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 31. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 235.7 bits 769,  Expect = 5e-64
 Identities = 119/159 74%, Positives = 131/159 82%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV++  G++IK+TS Y
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIE YL  H   YN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 32. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 234.5 bits 765,  Expect = 1e-63
 Identities = 118/159 74%, Positives = 132/159 83%, Gaps = 0/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE EFTS IP  +L+ AFVLDADNLIPKIAPQAVK  EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            EGS Y YVKHKI  +DK+N  Y YS+IEGDA+S+ IEKI YETKLV++  G++IK+ S Y
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIE YL +H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 33. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 230.0 bits 750,  Expect = 2e-62
 Identities = 116/159 72%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE EFTS IP  KLFKAF+LDADNLIPK+AP AVK  EILEGDGG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS+Y YVKH++  IDK+N +YSY+LIEGDALSD IE I Y+ KLV++P G +I+KTTS 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YL  +P  YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 34. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 226.7 bits 739,  Expect = 2e-61
 Identities = 114/159 71%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG++TY +E TS IP P+LFKA+VL+AD LIPKIAPQ+VK AEI+EGDGG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLV-SAPHGTIIKTTSK 119
            EGSHY YVKH+I  +DK+N  Y+YSL+EGDALSD +EKI YE KLV SA  G++IK+TS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGDVEIKEE VKAGKEKA+ LFKLIE YL  +P  YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 35. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 219.2 bits 714,  Expect = 4e-59
 Identities = 112/158 70%, Positives = 131/158 82%, Gaps = 3/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE E TS IP  +LFKAFVLDADNLIPK+ PQAVK +EI+EG+GGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH--GTIIKTTS 118
            EGS+Y YVKH+  +ID+ N TY+YS+IEGDAL+D IEKI YETK+V A H  G+I+K+ S
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIV-ASHEGGSILKSIS 119
Query  119  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
             YH+KGD EIKEE VK GKEKAS LFK +EGYL  HP  YN
Sbjct  120  HYHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 212.3 bits 691,  Expect = 5e-57
 Identities = 106/159 66%, Positives = 131/159 82%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+ENE TS IP  +LFKAFVLDADNLIPK+AP+A+K AEI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS++ YVKH+I  ID+ N TY YS+IEGD +++ +EKI YE K+V++P G +I+K TSK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ EIKEE V AGKEKA+ LFK +E YL  H   YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 211.1 bits 687,  Expect = 1e-56
 Identities = 104/159 65%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+E T+ I   +LFKAFVLDADNLIPK+APQA+K +EI+EG GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS++ YVKH+I  ID  N TY+ +LIEGDA+S+ +EKI YE KLV++P G +I+K+TSK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD EIKE+++KAGKE+AS +FK +E YL  +P+ Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 210.0 bits 683,  Expect = 3e-56
 Identities = 101/159 63%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IP  +LFK FVLD+DNLIPK+AP+A+K  EI+EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + Y+K+K+  ID+ N +Y YS+IEGDALSD +EKI+YE K+V++PHG +I+K+ SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHT GD E+K+E++KAGKEKAS LFK +EGYL  H   YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 203.4 bits 661,  Expect = 3e-54
 Identities = 102/159 64%, Positives = 129/159 81%, Gaps = 2/159 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+EFTS I   +LFKAFVLD DNL+PKIAPQAV+  EILEG+GG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDN-IEKIDYETKLV-SAPHGTIIKTTS 118
            +G  + YVKHKI +IDKE+ TYSYS+IEGDAL  N +EKI +E+KLV S   G +IKT S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            KY++ GD ++ EE VK G+++A++++K +E YLKDHP  YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 40. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 202.5 bits 658,  Expect = 5e-54
 Identities = 98/158 62%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+TYE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P G +I+K+TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 41. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 201.6 bits 655,  Expect = 9e-54
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS I   +LFK+FVLDADNLIPK+AP+ V  AE +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSH+ Y+KH++  ID  N  Y YS+IEG  L D +EKI YE K+V+AP G +I+K TSK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD+ + EE +KAGKEK + LFK +E YL  HP+ YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 199.8 bits 649,  Expect = 3e-53
 Identities = 99/158 62%, Positives = 119/158 75%, Gaps = 2/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV++YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG--TIIKTTS 118
            EGS + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHG  +I+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 198.9 bits 646,  Expect = 6e-53
 Identities = 99/158 62%, Positives = 118/158 74%, Gaps = 2/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG--TIIKTTS 118
            EGS + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHG  +I+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 44. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 198.9 bits 646,  Expect = 6e-53
 Identities = 98/158 62%, Positives = 119/158 75%, Gaps = 2/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV++YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG--TIIKTTS 118
            EG+ + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHG  +I+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 198.3 bits 644,  Expect = 9e-53
 Identities = 98/158 62%, Positives = 118/158 74%, Gaps = 2/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IP  +LFK+FVLDADNLIPK+APQ    AE LEG+GGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG--TIIKTTS 118
            EG+ + Y+KHK+  ID  N  Y YS+IEG  L   +EKI YE K+ +APHG  +I+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            KYHTKG+  I EE +KAGKEKA+ LFK +E YL  HP  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 46. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 195.9 bits 636,  Expect = 5e-52
 Identities = 95/158 60%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV  YE+E  S IP  +LFKAFVLD+DNLIPK+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSH  + KH+I  ID EN T+S+S+IEGDAL D +E +  ETK+V++P G +I+K+T K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 191.1 bits 620,  Expect = 1e-50
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E KLV+ P G +I+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K EH+KA KEKA  L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 190.8 bits 619,  Expect = 1e-50
 Identities = 96/137 70%, Positives = 111/137 81%, Gaps = 0/137 0%
Query  10   FTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVK 69
            +TS IP PKLFKAFVLDADNLIPKIAPQAVK  EI+EGDGG GT+KKI +GEG+ + YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKYHTKGDVEIK 129
            HKI  +DK N  YSYS+ EGDAL D IEKI YE KLV++  G+IIKTTS YH KG  EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVKAGKEKASHLFKL 146
            EE+VK GKE+A+ LFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 49. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 189.3 bits 614,  Expect = 4e-50
 Identities = 93/158 58%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSH  + KH+I  ID EN TYS+S+IEGDAL D +E +  ETK+V++P G +I K+TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL  HP  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 50. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 189.0 bits 613,  Expect = 5e-50
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 51. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 189.0 bits 613,  Expect = 5e-50
 Identities = 93/159 58%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD +NLIPK+APQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP G +I+K TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 52. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 188.7 bits 612,  Expect = 7e-50
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD +NLIPK+APQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP G +I+K ++K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+  EH+K GKEK   LF+ +E YL  H   YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 187.8 bits 609,  Expect = 1e-49
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE+E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            GS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E KLV+ P G +I+K ++KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 54. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 186.9 bits 606,  Expect = 2e-49
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 185.4 bits 601,  Expect = 6e-49
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 185.1 bits 600,  Expect = 8e-49
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 185.1 bits 600,  Expect = 8e-49
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP G +I+K TSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 184.8 bits 599,  Expect = 1e-48
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 183.6 bits 595,  Expect = 2e-48
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 60. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 182.4 bits 591,  Expect = 5e-48
 Identities = 91/158 57%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGVY YE++ TS IP  +LFKAFVLD+DNLI K+ P+AVK  EI+EG+GGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E S   Y KH+I ++D EN +YS+S+IEG+AL+D I  I  E K+V++P G +I+K+T+K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YL  HP  YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 61. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 181.5 bits 588,  Expect = 1e-47
 Identities = 88/158 55%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            GS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 62. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 181.2 bits 587,  Expect = 1e-47
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E KLV+ P G +I++ ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 180.6 bits 585,  Expect = 2e-47
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP G +I+K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 179.7 bits 582,  Expect = 3e-47
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 179.4 bits 581,  Expect = 4e-47
 Identities = 90/157 57%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQA+K  E +EG+GGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+D +  +  E K+V++P G +I K+T+K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            Y+TKGD ++KEE+++A  EK + L K +E YL  HP  Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 66. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 178.5 bits 578,  Expect = 8e-47
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+G +I+K  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 178.2 bits 577,  Expect = 9e-47
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 178.2 bits 577,  Expect = 9e-47
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+G +I+K  +K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 178.2 bits 577,  Expect = 9e-47
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 177.9 bits 576,  Expect = 1e-46
 Identities = 84/155 54%, Positives = 115/155 74%, Gaps = 1/155 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV TY+ E  S +P  KL+KAF+LD D L+PK+ P+A+KC +ILEGDG  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGSH+  VK+++ +IDK+N TYSY++IEGD L++  E I Y  K+V+ P G +I K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +P
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 71. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 177.9 bits 576,  Expect = 1e-46
 Identities = 87/158 55%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            G  + YVK ++  +D  N  YSYSLIEG  + D +EKI  E K+V+ P G +I+K ++KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 72. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 177.9 bits 576,  Expect = 1e-46
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 177.6 bits 575,  Expect = 1e-46
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 177.6 bits 575,  Expect = 1e-46
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+G +I+K  +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 177.3 bits 574,  Expect = 2e-46
 Identities = 87/159 54%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFKAF+LD D L+PK+AP+AV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + YVK ++  +D+ N  YS+S+IEG A+ D +EK+  E K+V+AP G +I+K ++K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +HTKGD EI  E++K  KEKA  L+K +E YL  H   YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 177.3 bits 574,  Expect = 2e-46
 Identities = 83/159 52%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L DN+EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 77. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 176.7 bits 572,  Expect = 3e-46
 Identities = 88/157 56%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+  +E +  E K V++P G +I+K+T+K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL  HP  Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 78. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 176.7 bits 572,  Expect = 3e-46
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +  +N  YSYS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 176.1 bits 570,  Expect = 4e-46
 Identities = 85/158 53%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            GS   YVK ++  ID  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            H KG  E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 80. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 175.8 bits 569,  Expect = 5e-46
 Identities = 86/148 58%, Positives = 112/148 75%, Gaps = 1/148 0%
Query  4    YTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGS 63
            + YE+E TS IPA +LFKAF+L+ DNLIPK+APQA+   E +EG+GGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   HYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKYHT 122
             + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P G +I+K ++KYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            KGD E+K EH+KA KEK   L++ +E YL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 81. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 175.5 bits 568,  Expect = 6e-46
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 82. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 175.5 bits 568,  Expect = 6e-46
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 83. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 175.2 bits 567,  Expect = 8e-46
 Identities = 86/158 54%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFKAF+LD D L+PK+AP+AV   E +EG+GGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            GS + YVK ++  +D+ N  YS+S+IEG A+ D +EK+  E K+V+AP G +I+K ++K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            HTKGD EI  E++K  KEKA  L+K +E YL  H   YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 84. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 175.2 bits 567,  Expect = 8e-46
 Identities = 82/159 51%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 175.2 bits 567,  Expect = 8e-46
 Identities = 81/159 50%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +++K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 86. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 175.2 bits 567,  Expect = 8e-46
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 87. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 174.9 bits 566,  Expect = 9e-46
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 88. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 174.9 bits 566,  Expect = 9e-46
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 89. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 174.6 bits 565,  Expect = 1e-45
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 174.6 bits 565,  Expect = 1e-45
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 174.3 bits 564,  Expect = 1e-45
 Identities = 82/159 51%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 92. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 174.3 bits 564,  Expect = 1e-45
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 174.3 bits 564,  Expect = 1e-45
 Identities = 84/159 52%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE+E TS IPA +LFKAF+L+ DNLIPK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 94. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 174.3 bits 564,  Expect = 1e-45
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 174.3 bits 564,  Expect = 1e-45
 Identities = 82/159 51%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + +VK ++  +D  N  YSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 172.8 bits 559,  Expect = 4e-45
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S I A +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS Y YVK ++  +D  N  YSY++IEGD L D +EK+  E K+V+AP G + +K +SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 97. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 172.5 bits 558,  Expect = 5e-45
 Identities = 83/159 52%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
             G  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 98. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 172.5 bits 558,  Expect = 5e-45
 Identities = 82/159 51%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E TS IPA ++FKAF+LD D L+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 99. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 171.6 bits 555,  Expect = 9e-45
 Identities = 81/159 50%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E K+V+AP G +I+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 170.1 bits 550,  Expect = 3e-44
 Identities = 80/158 50%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            GS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            H KG  E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 168.6 bits 545,  Expect = 7e-44
 Identities = 79/159 49%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+ YE E  S +PA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E  +V+AP G +I+K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 166.2 bits 537,  Expect = 4e-43
 Identities = 78/158 49%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQ +   E + G+GGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
            G  + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            H KG  E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 162.0 bits 523,  Expect = 7e-42
 Identities = 78/148 52%, Positives = 105/148 70%, Gaps = 1/148 0%
Query  4    YTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGS 63
            + YE E TS IPA +LFKAF+LD DNL PK+APQA+   + +EG+GGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   HYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKYHT 122
             + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  I+K ++KYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            KG+ E+K E+VKA KE    L++ +E YL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 159.9 bits 516,  Expect = 3e-41
 Identities = 85/154 55%, Positives = 104/154 67%, Gaps = 2/154 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  TY+ E  S I A K+FKAFVLD D +IPK  P+A+   + LEGDGG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EGS +  VKH+I  +DKEN TYSYS+IEG AL D  E I Y  K+V+ P G  I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
            Y  K D ++ EE +KAGKE+AS +FK +E YL  +P
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 154.8 bits 499,  Expect = 1e-39
 Identities = 84/157 53%, Positives = 108/157 68%, Gaps = 3/157 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E  S +    L+KA+V DADN+IPK A  + K  E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E     +V HKI SID+ N  YSYS++ G AL D  EKI +++KLV+ P+G +  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159
            Y TKGD E  ++ +K GK KA  LFK IE YL  HP +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 153.3 bits 494,  Expect = 3e-39
 Identities = 80/156 51%, Positives = 109/156 69%, Gaps = 3/156 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E+E TS +P  KL+ A + DAD++ PKI    VK  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+G +I K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 152.1 bits 490,  Expect = 7e-39
 Identities = 81/158 51%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+ +E T+ I   +LFK +VLD D+L+PK+  + VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG    Y+KHKIH ID +N    YSLIEGD L D +E I Y+ K+ +A  G  + KTT++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 148.5 bits 478,  Expect = 8e-38
 Identities = 74/155 47%, Positives = 103/155 66%, Gaps = 1/155 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E     +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+G ++IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
            YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 147.6 bits 475,  Expect = 2e-37
 Identities = 77/158 48%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +G  + KTT++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158
            YHTKGD  + EE    G+E+  ++ K +E YL  +PS Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 147.0 bits 473,  Expect = 2e-37
 Identities = 75/154 48%, Positives = 105/154 68%, Gaps = 2/154 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            M V+T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            E     +V HKI  ID+ N  YSYS++ G AL D  EKI  ++KL   P+G +++K + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 146.4 bits 471,  Expect = 3e-37
 Identities = 73/154 47%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
            GV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
                 +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+G ++IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 139.3 bits 447,  Expect = 5e-35
 Identities = 69/150 46%, Positives = 102/150 68%, Gaps = 1/150 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV+T+E E TS +P  KLFKA V+D D L PK+ P A++  EI+EG+GGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            E     YV HKI +ID+  +TY Y++  G  + + +EK+ ++TKL +A  G+ IK +  +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            HTKGD  + +E  +  K+K+  +FK IEGY+
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYV 150

Sequence Alignment: 113. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 136.7 bits 438,  Expect = 2e-34
 Identities = 92/99 92%, Positives = 96/99 96%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
            AFVLDADNLIPK                      KITFGEGS+YGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKYHTKGDVEIKEEHVKAGKEKA 140
                 +EGDALSD +EKIDYETKLVSAP   TIIKTTSKYHTKGDVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  SHLFKLIEGYLKDHPSEYN 159
            +HLFKLIEGYLKDHPSEYN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 114. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 137.1 bits 440,  Expect = 2e-34
 Identities = 73/154 47%, Positives = 101/154 65%, Gaps = 2/154 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            M V+T++++ TS +    L+ A+  DADN+IPK A  + +  EI+EG+GGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVS-APHGTIIKTTSK 119
            E     +V HKI S+D+ N  YSYS++ G AL D  EKI  +TK+   A  G++IK T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
            YH KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 115. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 135.3 bits 434,  Expect = 9e-34
 Identities = 70/145 48%, Positives = 94/145 64%, Gaps = 1/145 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV TY  E T+ I   +LFKA+VLD DNL+PK+  Q VK  E +EGDGG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
            EG    Y+KHKIH ID +N    YSLIEGD L + +E I Y+ K+ +  +G  + KTT++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFK 145
            YHTKGD  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 116. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 135.1 bits 433,  Expect = 9e-34
 Identities = 69/151 45%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV   E   TS +PA KLFKA+ LD D L+P++ P A+K  EILEGDGG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLV-SAPHGTIIKTTSK 119
            + S Y  +K+KI +IDKE  T+SYS+I+GD L   I+ I+    +V +A  G    +T+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            ++TKGD  + EE++K   ++ + +FK +E YL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 129.1 bits 413,  Expect = 6e-32
 Identities = 69/150 46%, Positives = 99/150 66%, Gaps = 2/150 1%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV T+  E+TS + A K+F+ FV+D D ++PK AP A K  EI +GDGGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLV-SAPHGTIIKTTSK 119
            +G     +  +I  ++KE  T+ YS+I+GD L   IE I+    LV +A  G+I KTT+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            +HTKGD  + EE++K   E+ + LFK +E YL
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151

Sequence Alignment: 118. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 127.3 bits 407,  Expect = 2e-31
 Identities = 63/151 41%, Positives = 92/151 60%, Gaps = 0/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV     E  S + A K+++ F+LD D + PK+ PQ +K  EILEGDGG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            E + Y  +K+K+  IDK    Y+Y+ I GD L D +E +  E  +V    G I+K T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            +TKGD  + E+ +K   EK++  FK +E YL
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYL 151

Sequence Alignment: 119. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 126.7 bits 405,  Expect = 3e-31
 Identities = 62/151 41%, Positives = 93/151 61%, Gaps = 0/151 0%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MGV   E E  S + A K+++ F+LD D + PK+ PQ +K  EILEGDGG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
            E + Y  +K+K+  IDK    Y+Y+ I GD L + +E +  +  +V    G I+K T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            +TKGD  + E+ VK   EK++  FK +E YL
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYL 151

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 118.9 bits 379,  Expect = 7e-29
 Identities = 67/148 45%, Positives = 94/148 63%, Gaps = 6/148 4%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
            EGS    +  +  +++KE  TY  ++I+GD L   IE I  ET LV  P    G+I KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            + +HTKGD  + EE++K   E+ + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYL 151

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 118.0 bits 376,  Expect = 1e-28
 Identities = 67/148 45%, Positives = 93/148 62%, Gaps = 6/148 4%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
            EGS    +  +  +++KE  TY  ++I+GD L   IE I  ET LV  P    G+I KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 117.1 bits 373,  Expect = 2e-28
 Identities = 65/148 43%, Positives = 94/148 63%, Gaps = 6/148 4%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
            EGS    +  +  +++KE  TY  ++I+GD L + IE I  ET +V  P    G+I KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 123. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 117.1 bits 373,  Expect = 2e-28
 Identities = 60/149 40%, Positives = 87/149 58%, Gaps = 1/149 0%
Query  7    ENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYG 66
            E E TS +    +FKAFV+D D + PK  P+  K  + +EGDGG GTIK IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLV-SAPHGTIIKTTSKYHTKGD 125
              KHK+ +ID  N + SY++ EGD L   IE   +  K++ SA  G++ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  VEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155
             ++ +E+V   KE     FK IE Y+  HP
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 116.4 bits 371,  Expect = 4e-28
 Identities = 65/148 43%, Positives = 94/148 63%, Gaps = 6/148 4%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
            EGS    +  +  +++KE  TY  ++I+GD L + IE I  ET +V  P    G+I KTT
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 165

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 113.2 bits 360,  Expect = 3e-27
 Identities = 64/148 43%, Positives = 92/148 62%, Gaps = 6/148 4%
Query  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
            EGS    +  +  +++KE  +Y  ++I+GD L   IE I  ET +V  P    G+I KTT
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 64.7 bits 197,  Expect = 4e-13
 Identities = 29/50 58%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGP 51
            GV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 56.2 bits 170,  Expect = 5e-10
 Identities = 38/129 29%, Positives = 59/129 45%, Gaps = 4/129 3%
Query  24   VLDAD--NLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
            VL  D   ++PK+ P+ VK  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKYHTKGDVEIKEEHVKAGKEKA 140
                +IEG  L+  +       KL       T++     Y    D+E K    K  +   
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
Query  141  SHLFKLIEGYLKD 153
             +L +L E YL +
Sbjct  141  MYLRRL-ERYLSN 152

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 34.1 bits 94,  Expect = 0.0003
 Identities = 15/24 62%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVYTYENEFTSDIPAPKLFKAFVL 25
            GV+T+E++ TS IP  +LFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.