The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG
TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS
LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ
GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG
SDGVAK
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9ARG0 Cap a 1.0101 246 1808 357.1 3.1e-100
CAC34055 Cap a 1w 246 1808 357.1 3.1e-100
P12670 Lyc e NP24 247 1613 319.5 6.6e-89
AAG34078 Cap a 1 180 1225 244.8 1.5e-66
P81370 Act c 2 225 1112 222.8 7.5e-60
1Z3Q_A Mus a 4.0101 200 1109 222.3 9.6e-60
E3SU11 Ole e 13.0101 226 1099 220.3 4.3e-59
P81295 Jun a 3 225 824 167.2 4.1e-43
AAR21074 Cup s 3.0102 225 814 165.3 1.5e-42
AAR21073 Cup s 3.0101 225 814 165.3 1.5e-42
CAC05258 Cup a 3 199 800 162.7 8.5e-42
ACE80955 Pru p 2.0301 242 479 100.6 5e-23
P50694 Pru av 2 245 455 96.0 1.2e-21
AAF80167 Jun v 3.010101 97 408 87.4 1.9e-19
AAF80165 Jun v 3.010102 97 408 87.4 1.9e-19
CAC10270 Mal d 2 246 252 56.8 7.8e-10
ACE80957 Pru p 2.0201 246 245 55.5 2e-09
ACE80959 Pru p 2.0101 246 243 55.1 2.6e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 357.1 bits 1808,  Expect = 3e-100
 Identities = 246/246 100%, Positives = 246/246 100%, Gaps = 0/246 0%
Query  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
            MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG
Sbjct  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
Query  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
            TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS
Sbjct  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
Query  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
            LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ
Sbjct  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
Query  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
            GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG
Sbjct  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
Query  241  SDGVAK 246
            SDGVAK
Sbjct  241  SDGVAK 246

Sequence Alignment: 2. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 357.1 bits 1808,  Expect = 3e-100
 Identities = 246/246 100%, Positives = 246/246 100%, Gaps = 0/246 0%
Query  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
            MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG
Sbjct  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
Query  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
            TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS
Sbjct  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
Query  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
            LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ
Sbjct  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
Query  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
            GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG
Sbjct  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
Query  241  SDGVAK 246
            SDGVAK
Sbjct  241  SDGVAK 246

Sequence Alignment: 3. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 319.5 bits 1613,  Expect = 7e-89
 Identities = 218/246 88%, Positives = 229/246 93%, Gaps = 1/246 0%
Query  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
            MGYL SSFVLF+L  VTYTYAAT EVRNNCPYTVWAASTP+GGGRRL+RGQTW INAP G
Sbjct  1    MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG 60
Query  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
            T MARIWGRT CNF+ +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF+NLDFWDIS
Sbjct  61   TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS 120
Query  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
            LVDGFNIPMTFAPT PSGGKCHAI+CTANINGECP +L+VPGGCNNPCTTFGGQQYCCTQ
Sbjct  121  LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ 180
Query  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
            GPCGPTELSKFFKKRCPDAYSYPQDD TSTFTCP GSTNYRVVFCPNGV  PNFPLEMP 
Sbjct  181  GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA 240
Query  241  S-DGVAK 246
            S D VAK
Sbjct  241  STDEVAK 247

Sequence Alignment: 4. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 244.8 bits 1225,  Expect = 2e-66
 Identities = 154/179 86%, Positives = 167/179 93%, Gaps = 0/179 0%
Query  28   NNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGSCQTGDC 87
            NNCPYTVWAA+TPVGGG+RL+RGQ+W   APPGT MARIWGRTNCNFDG+GRG CQTGDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
Query  88   GGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIQCT 147
            GGVL+C GWGKPPNTLAEYALNQF+NLDFWDIS++DGFNIPM+F PT P  GKCH IQC 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
Query  148  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDD 206
            ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPT+LS+FFK+RCPDAYSYPQDD
Sbjct  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDD 179

Sequence Alignment: 5. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 222.8 bits 1112,  Expect = 8e-60
 Identities = 151/219 68%, Positives = 173/219 78%, Gaps = 4/219 1%
Query  4    LRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAM 63
            L  S +LF+  + T    ATF + NNCP+TVWAA+ P GGG+RLDRGQ W IN   GT  
Sbjct  7    LSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVP-GGGKRLDRGQNWIINPGAGTKG 65
Query  64   ARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVD 123
            AR+W RT CNFDG+GRG CQTGDC G+LQC  +G+PPNTLAEYALNQFNNLDF+DISLVD
Sbjct  66   ARVWPRTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVD 125
Query  124  GFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPC 183
            GFN+ M F+PT  SGG    I+CTA+ING+CP  LR PGGCNNPCT F   QYCC  G C
Sbjct  126  GFNVAMEFSPT--SGGCTRGIKCTADINGQCPNELRAPGGCNNPCTVFKTDQYCCNSGNC 183
Query  184  GPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
            G T +SKFFK RCPDAYSYP+DD TSTFTCP+G TNY+VVFCP
Sbjct  184  GLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAG-TNYKVVFCP 225

Sequence Alignment: 6. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 222.3 bits 1109,  Expect = 1e-59
 Identities = 146/200 73%, Positives = 168/200 84%, Gaps = 5/200 2%
Query  22   ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGS 81
            ATFE+ N C YTVWAA+ P GGGR+L++GQ+WTIN   GT   RIWGRT C+FDGSGRG 
Sbjct  1    ATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGR 59
Query  82   CQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKC 141
            CQTGDCGGVL CT +G PPNTLAE+ALNQFNNLDF+DISLVDGFN+PM F+PT  SGG C
Sbjct  60   CQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT--SGG-C 116
Query  142  HAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYS 201
              I+C A+ING+CPG+L+ PGGCNNPCT F   QYCC  G C PT+ S+FFK+ CPDAYS
Sbjct  117  RGIRCAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYS 176
Query  202  YPQDDATSTFTCPSGSTNYRVVFCP 226
            YP+DD T+TFTCP G TNYRVVFCP
Sbjct  177  YPKDDQTTTFTCPGG-TNYRVVFCP 200

Sequence Alignment: 7. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 220.3 bits 1099,  Expect = 4e-59
 Identities = 147/212 69%, Positives = 171/212 80%, Gaps = 7/212 3%
Query  10   LFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGR 69
            L+ + F  YT+AATF++ N C YTVWAA++P GGGRRLD+GQ+W IN  PGT  ARIWGR
Sbjct  13   LWAITFFAYTHAATFDIVNQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWGR 71
Query  70   TNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPM 129
            TNCNFD +GRG C+TGDC G+L+C G+G+PPNTLAE+ALNQ NNLDF DIS VDGFNIP+
Sbjct  72   TNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPL 131
Query  130  TFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGP--CGPTE 187
             F+PT      C  + C A I  +CP  LR PGGCNNPCT F   +YCCT GP  CGPT 
Sbjct  132  EFSPTT---NVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTP 188
Query  188  LSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
            LS+FFK+RCPDAYSYPQDD TS FTCP+G TNYRVVFCP
Sbjct  189  LSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRVVFCP 226

Sequence Alignment: 8. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 167.2 bits 824,  Expect = 4e-43
 Identities = 116/194 59%, Positives = 138/194 71%, Gaps = 12/194 6%
Query  24   FEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGSCQ 83
            F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+GSCQ
Sbjct  29   FDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQ 87
Query  84   TGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHA 143
            TGDCGG L CT  G  P TLAEY     ++ D++D+SLVDGFNIP+   PTN    +C A
Sbjct  88   TGDCGGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTN---AQCTA 141
Query  144  IQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCPDAY 200
              C A+IN  CP  L+V GGCN+ C  F   QYCC       C  T  SK FK +CP AY
Sbjct  142  PACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATNYSKIFKNQCPQAY 201
Query  201  SYPQDDATSTFTCPSGSTNYRVVFCP 226
            SY +DD T+TF C SG T+Y +VFCP
Sbjct  202  SYAKDD-TATFACASG-TDYSIVFCP 225

Sequence Alignment: 9. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 165.3 bits 814,  Expect = 2e-42
 Identities = 115/197 58%, Positives = 139/197 70%, Gaps = 12/197 6%
Query  21   AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRG 80
            A  F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+G
Sbjct  26   AVKFDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
Query  81   SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGK 140
            SC++GDCGG L CT  G  P TLAEY  +   + D++D+SLVDGFNIP+   PTN    K
Sbjct  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQS---DKDYYDVSLVDGFNIPLAINPTNT---K 138
Query  141  CHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
            C A  C A+IN  CP  L+V GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
Query  198  DAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
             AYSY +DD T+TF C SG T+Y +VFCP
Sbjct  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225

Sequence Alignment: 10. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 165.3 bits 814,  Expect = 2e-42
 Identities = 115/197 58%, Positives = 139/197 70%, Gaps = 12/197 6%
Query  21   AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRG 80
            A  F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+G
Sbjct  26   AVKFDIKNQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
Query  81   SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGK 140
            SC++GDCGG L CT  G  P TLAEY  +   + D++D+SLVDGFNIP+   PTN    K
Sbjct  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNT---K 138
Query  141  CHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
            C A  C A+IN  CP  L+V GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
Query  198  DAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
             AYSY +DD T+TF C SG T+Y +VFCP
Sbjct  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225

Sequence Alignment: 11. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 162.7 bits 800,  Expect = 9e-42
 Identities = 112/194 57%, Positives = 137/194 70%, Gaps = 12/194 6%
Query  24   FEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGSCQ 83
            F+++N C YTVWAA  P GGG+ +D+GQTWT+N   GTA AR WGRT C FD SG+GSC+
Sbjct  3    FDIKNQCGYTVWAAGLP-GGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCR 61
Query  84   TGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHA 143
            +GDCGG L CT  G  P TLAEY     ++ D++D+SLVDGFNIP+   PTN    KC A
Sbjct  62   SGDCGGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---KCTA 115
Query  144  IQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCPDAY 200
              C A+IN  CP  L+V GGCN+ C  +   QYCC       C  T  SK FK +CP AY
Sbjct  116  PACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVNNCPATNYSKIFKNQCPQAY 175
Query  201  SYPQDDATSTFTCPSGSTNYRVVFCP 226
            SY +DD T+TF C SG T+Y +VFCP
Sbjct  176  SYAKDD-TATFACASG-TDYSIVFCP 199

Sequence Alignment: 12. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 100.6 bits 479,  Expect = 5e-23
 Identities = 102/215 47%, Positives = 129/215 60%, Gaps = 23/215 10%
Query  7    SFVLFLLAFVTYTYAATFEVRNNCPYTVWAAS--TP--VGGGRRLDRGQTWTINAP-PGT 61
            S+ L LL+F    +AAT   +NNCPYTVW AS   P     G  L    ++ ++ P P +
Sbjct  10   SLSLTLLSF-GGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS 68
Query  62   AMARIWGRTNCNFDGSGRGSCQTGDC-GGVLQCTGW-GKPPNTLAEYALNQFNNLDFWDI 119
               R W RT C+ D SG+  C+T DC  G L C G  G PP TLAE+ +      DF+D+
Sbjct  69   G--RFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDV 126
Query  120  SLVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTTFGG 173
            SLVDGFN+PM+  P   +G  C    C AN+N  CP  L+  G       C + C  FG 
Sbjct  127  SLVDGFNLPMSVTPQGGTG-TCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGE 185
Query  174  QQYCCT-----QGPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
             QYCCT     +  C PT  S+ F ++CPDAYSY  DD    FTC SG  NY + FCP
Sbjct  186  PQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTC-SGGPNYLITFCP 242

Sequence Alignment: 13. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 96.0 bits 455,  Expect = 1e-21
 Identities = 97/215 45%, Positives = 123/215 57%, Gaps = 26/215 12%
Query  7    SFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGG-------GRRLDRGQTWTINAP- 58
            S+ L +L+F    +AAT   +NNCPY VW  +            G  L    ++ ++ P 
Sbjct  10   SLSLTILSF-GGAHAATISFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQASFQLDTPV 68
Query  59   PGTAMARIWGRTNCNFDGSGRGSCQTGDCG-GVLQCTGWGK-PPNTLAEYALNQFNNLDF 116
            P     R W RT C+ D SG+  C T DC  G + C G G  PP TLAE+ +      DF
Sbjct  69   PWNG--RFWARTGCSTDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAGGGQDF 126
Query  117  WDISLVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTT 170
            +D+SLVDGFN+PM+  P   +G  C    C AN+N  CP  L+  G       C + C  
Sbjct  127  YDVSLVDGFNLPMSVTPQGGTGD-CKTASCPANVNAVCPSELQKKGSDGSVVACLSACVK 185
Query  171  FGGQQYCCT---QGP--CGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFC 225
            FG  QYCCT     P  C PT  S+ F   CPDAYSY  DD   TFTC +G  NY + FC
Sbjct  186  FGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTC-NGGPNYAITFC 244
Query  226  P 226
            P
Sbjct  245  P 245

Sequence Alignment: 14. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 87.4 bits 408,  Expect = 2e-19
 Identities = 56/85 65%, Positives = 63/85 74%, Gaps = 1/85 1%
Query  21   AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRG 80
            A  F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+G
Sbjct  6    AVKFDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 64
Query  81   SCQTGDCGGVLQCTGWGKPPNTLAEY 106
            SCQTGDCG  L CT  G  P TLAEY
Sbjct  65   SCQTGDCGRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 15. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 87.4 bits 408,  Expect = 2e-19
 Identities = 56/85 65%, Positives = 63/85 74%, Gaps = 1/85 1%
Query  21   AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRG 80
            A  F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+G
Sbjct  6    AVKFDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 64
Query  81   SCQTGDCGGVLQCTGWGKPPNTLAEY 106
            SCQTGDCG  L CT  G  P TLAEY
Sbjct  65   SCQTGDCGRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 16. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 56.8 bits 252,  Expect = 8e-10
 Identities = 96/208 46%, Positives = 126/208 60%, Gaps = 25/208 12%
Query  15   FVTYTYAATFEVRNNCPYTVWAASTPVGG--------GRRLDRGQTWTINAPPGTAMARI 66
            F +  +AA     NNCP TVW   T  G         G  L    + +++AP   +  R 
Sbjct  18   FFSGAHAAKITFTNNCPNTVWPG-TLTGDQKPQLSLTGFELASKASRSVDAPSPWS-GRF 75
Query  67   WGRTNCNFDGSGRGSCQTGDCG-GVLQCTGWGK-PPNTLAEYALNQFNNLDFWDISLVDG 124
            WGRT C+ D +G+ +C+T DCG G + C G G  PP TL E  +      D++D+SLVDG
Sbjct  76   WGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDVSLVDG 135
Query  125  FNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTTFGGQQYCC 178
            FN+PM+ AP   +G +C    C AN+N  CP  L+V         C + C  FG  +YCC
Sbjct  136  FNLPMSVAPQGGTG-ECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCC 194
Query  179  T---QGP--CGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
            T     P  C PTE S+ F+K+CP AYSY  DD  STFTC SG  +Y + FCP
Sbjct  195  TPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTC-SGGPDYVITFCP 246

Sequence Alignment: 17. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 55.5 bits 245,  Expect = 2e-09
 Identities = 98/208 47%, Positives = 128/208 61%, Gaps = 25/208 12%
Query  15   FVTYTYAATFEVRNNCPYTVWAASTPVGG--------GRRLDRGQTWTINAPPGTAMARI 66
            F +  +AA     N C YTVW   T  G         G  L  G + +++AP   +  R 
Sbjct  18   FFSGAHAAKITFTNKCSYTVWPG-TLTGDQKPQLSLTGFELATGISNSVDAPSPWS-GRF 75
Query  67   WGRTNCNFDGSGRGSCQTGDCG-GVLQCTGWGK-PPNTLAEYALNQFNNLDFWDISLVDG 124
            +GRT C+ D SG+ +C T DCG G + C G G  PP TL E  + +    DF+D+SLVDG
Sbjct  76   FGRTRCSTDASGKFTCATADCGSGQVSCNGNGAVPPATLVEITIAENGGQDFYDVSLVDG 135
Query  125  FNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTTFGGQQYCC 178
            FN+PM+ AP   +G +C A  C A+IN  CP  L+V G       C + C  +   QYCC
Sbjct  136  FNLPMSVAPQGGTG-ECKASTCPADINKVCPAELQVKGSDGSVIACKSACLALNQPQYCC 194
Query  179  T---QGP--CGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
            T     P  C PT+ SK+FK +CP AYSY  DD +STFTC SG  +Y + FCP
Sbjct  195  TPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTC-SGRPDYLITFCP 246

Sequence Alignment: 18. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 55.1 bits 243,  Expect = 3e-09
 Identities = 99/208 47%, Positives = 128/208 61%, Gaps = 25/208 12%
Query  15   FVTYTYAATFEVRNNCPYTVWAASTPVGG--------GRRLDRGQTWTINAPPGTAMARI 66
            F +  +AA     N C YTVW   T  G         G +L  G + +++AP   +  R 
Sbjct  18   FFSGAHAAKITFTNKCSYTVWPG-TLTGDQKPQLSLTGFKLATGISRSVDAPSPWS-GRF 75
Query  67   WGRTNCNFDGSGRGSCQTGDCG-GVLQCTGWGK-PPNTLAEYALNQFNNLDFWDISLVDG 124
            +GRT C+ D SG+ +C T DCG G + C G G  PP TL E  +      DF+D+SLVDG
Sbjct  76   FGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIASNGGQDFYDVSLVDG 135
Query  125  FNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTTFGGQQYCC 178
            FN+PM+ AP   +G KC A  C A+IN  CP  L+V G       C + C  F   +YCC
Sbjct  136  FNLPMSVAPQGGTG-KCKASTCPADINKVCPAPLQVKGSDGSVIACKSACLAFNQPKYCC 194
Query  179  T---QGP--CGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226
            T     P  C PT+ SK+FK +CP AYSY  DD +STFTC SG  +Y + FCP
Sbjct  195  TPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTC-SGRPDYLITFCP 246

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.