The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE
ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL
VCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA32835 Bos d 5 178 1160 271.4 1e-74
P02754 Bos d 5 178 1140 266.9 2.4e-73
AAA30411 Bos d 5 151 984 231.4 9.6e-63
AAS77253 Fel d 4 186 227 58.7 1.1e-10
Q95182 Equ c 1 187 202 53.0 5.9e-09
XP_855342 Can f 6.0101 190 201 52.8 7.1e-09
S0BDX9 Cav p 6.0101 181 197 51.9 1.2e-08
O18874 Can f 2 180 193 51.0 2.3e-08
P02761 Rat n 1 181 189 50.1 4.4e-08
AAA39768 Mus m 1.0102 180 179 47.8 2.1e-07
P02762 Mus m 1 180 177 47.3 2.9e-07
ADK56160 Fel d 7.0101 180 175 46.9 4e-07
O18873 Can f 1 174 156 42.6 7.7e-06
Q9QXU1 Mes a 1.0101 172 124 35.3 0.0012
U6C8D6 Ory c 4.0101 172 118 33.9 0.0031
AAA30413 Bos d 5 14 87 29.7 0.0046
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 271.4 bits 1160,  Expect = 1e-74
 Identities = 178/178 100%, Positives = 178/178 100%, Gaps = 0/178 0%
Query  1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE 60
            MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE
Sbjct  1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE 60
Query  61   ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL 120
            ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL
Sbjct  61   ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL 120
Query  121  VCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178
            VCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sbjct  121  VCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178

Sequence Alignment: 2. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 266.9 bits 1140,  Expect = 2e-73
 Identities = 175/178 98%, Positives = 175/178 98%, Gaps = 0/178 0%
Query  1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE 60
            MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE
Sbjct  1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE 60
Query  61   ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL 120
            ELKPTPEGDLEILLQKWEN ECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL
Sbjct  61   ELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL 120
Query  121  VCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178
             CMENSAEPEQSL CQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sbjct  121  FCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178

Sequence Alignment: 3. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 231.4 bits 984,  Expect = 1e-62
 Identities = 150/151 99%, Positives = 150/151 99%, Gaps = 0/151 0%
Query  28   IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 87
            IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI
Sbjct  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
Query  88   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLVCMENSAEPEQSLVCQCLVRTPEVDDE 147
            IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL CMENSAEPEQSLVCQCLVRTPEVDDE
Sbjct  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
Query  148  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178
            ALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sbjct  121  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 151

Sequence Alignment: 4. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 58.7 bits 227,  Expect = 1e-10
 Identities = 46/150 30%, Positives = 82/150 54%, Gaps = 6/150 4%
Query  1    MKCLLLALAL--TCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
            MK LLL L L   C  +   V ++   +DI K++G WYS+ +A SD+     ++  +RV+
Sbjct  1    MKLLLLCLGLILVCAHEEENVVRS--NIDISKISGEWYSILLA-SDVKEKIEENGSMRVF 57
Query  59   VEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKY 118
            VE +K      L  +++  EN +C +  ++A+KTK   V+ +     N   +++T Y +Y
Sbjct  58   VEHIKALDNSSLSFVFHTKENGKCTEIFLVADKTK-DGVYTVVYDGYNVFSIVETVYDEY 116
Query  119  LLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDK 154
            +L+ + N  +     + +   R P+V  +  EKF K
Sbjct  117  ILLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVK 152

Sequence Alignment: 5. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 53.0 bits 202,  Expect = 6e-09
 Identities = 43/154 27%, Positives = 77/154 50%, Gaps = 7/154 4%
Query  1    MKCLLLALAL--TCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
            MK LLL L L   C  Q       ++ +DI K++G WYS+ +A SD+     ++  +RV+
Sbjct  1    MKLLLLCLGLILVCAQQEENSDVAIRNFDISKISGEWYSIFLA-SDVKEKIEENGSMRVF 59
Query  59   VEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKI--DALNENKVLVLDTDYK 116
            V+ ++      L    Q   N EC +  ++ +KT+   V+ +  D  N  ++  ++ D  
Sbjct  60   VDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEH 119
Query  117  KYLLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALK 157
              L +   +   P Q  + +   R P+V  E  E+F K ++
Sbjct  120  IILYLVNFDKDRPFQ--LFEFYAREPDVSPEIKEEFVKIVQ 158

Sequence Alignment: 6. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 52.8 bits 201,  Expect = 7e-09
 Identities = 43/174 24%, Positives = 88/174 50%, Gaps = 3/174 1%
Query  1    MKCLLLALALTCGAQALIVTQTMKG-LDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYV 59
            MK LLL L L            +KG +DI K++G WYS+ +A SDI     ++  +RV+V
Sbjct  1    MKLLLLCLGLILVHAHEEENDVVKGNFDISKISGDWYSILLA-SDIKEKIEENGSMRVFV 59
Query  60   EELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYL 119
            ++++      L   ++   N +C +  +I  KT+    + +     N   +++T Y+ Y+
Sbjct  60   KDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYI 119
Query  120  LVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC 176
            +  + N  + ++  + +   R P+V  +  EKF +  + + +     ++ TQ++ +C
Sbjct  120  IFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVD-RC 175

Sequence Alignment: 7. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 51.9 bits 197,  Expect = 1e-08
 Identities = 44/145 30%, Positives = 74/145 51%, Gaps = 10/145 6%
Query  6    LALALTCGAQALIVTQ-----TMKG-LDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYV 59
            + L L C    L+ TQ      ++G +D +K++G WY++   ASD      +   +RV+V
Sbjct  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVK-EASDKRETIEEGGSMRVFV 59
Query  60   EELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYL 119
            E ++P  +  L   +   EN EC Q  +I  +     V+ ++    N   V +TDYK Y 
Sbjct  60   ESIEPVKDSALSFKFWAHENGECKQISLICNRVA-EGVYAVEYDGYNVFRVAETDYKNYA 118
Query  120  LVCMEN-SAEPEQSLVCQCLVRTPEVDDEALEKFD 153
            +  + N  AE    L+ +   R P+V  E   +F+
Sbjct  119  IFQLRNFKAEGSFQLL-ELYGREPDVSGEIKTRFE 152

Sequence Alignment: 8. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 51.0 bits 193,  Expect = 2e-08
 Identities = 43/158 27%, Positives = 84/158 53%, Gaps = 8/158 5%
Query  1    MKCLLLA--LALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
            M+ LLL   LAL CG QA    +      +++++G W+S+A+A++   L+      +RV+
Sbjct  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGH-FRVF 59
Query  59   VEELKPTPEGDL--EILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYK 116
            +  +    +G+L  +IL+ +  + +C +  + A KT     F ++    N + + + D K
Sbjct  60   IHSMS-AKDGNLHGDILIPQ--DGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPK 116
Query  117  KYLLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMH 162
             YL++ M N    + SLV + +VR      + L  F+   + + +H
Sbjct  117  SYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLH 162

Sequence Alignment: 9. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 50.1 bits 189,  Expect = 4e-08
 Identities = 41/152 26%, Positives = 77/152 50%, Gaps = 3/152 1%
Query  4    LLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELK 63
            L L L L CG +A   + T   LD+ K+ G W+S+ +A++    ++ ++  +RV+++ + 
Sbjct  8    LCLGLTLVCG-HAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIE-ENGSMRVFMQHID 65
Query  64   PTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLVCM 123
               E  L   ++  EN EC +  ++A KT     + ++    N   +L TDY +Y++  +
Sbjct  66   VL-ENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHL 124
Query  124  ENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKA 158
             N    E   +     RT ++  +  EKF K  +A
Sbjct  125  INFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEA 159

Sequence Alignment: 10. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 47.8 bits 179,  Expect = 2e-07
 Identities = 37/151 24%, Positives = 79/151 52%, Gaps = 6/151 3%
Query  1    MKCLLL---ALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRV 57
            MK LLL    L L C  +A   + T + ++++K+ G W+++ +A SD       +  +R+
Sbjct  1    MKMLLLLCLGLTLVC-VHAEEASSTGRNFNVEKINGEWHTIILA-SDKREKIEDNGNFRL 58
Query  58   YVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKK 117
            ++E++    E  L + ++   ++EC++  ++A+KT+    + +     N   +  TDY  
Sbjct  59   FLEQIH-VLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDN 117
Query  118  YLLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDK 154
            +L+  + N  + E   +     R P++  +  E+F K
Sbjct  118  FLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAK 154

Sequence Alignment: 11. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 47.3 bits 177,  Expect = 3e-07
 Identities = 36/149 24%, Positives = 78/149 52%, Gaps = 6/149 4%
Query  1    MKCLLL---ALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRV 57
            MK LLL    L L C  +A   + T + ++++K+ G W+++ +A SD       +  +R+
Sbjct  1    MKMLLLLCLGLTLVC-VHAEEASSTGRNFNVEKINGEWHTIILA-SDKREKIEDNGNFRL 58
Query  58   YVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKK 117
            ++E++    E  L + ++   ++EC++  ++A+KT+    + +     N   +  TDY  
Sbjct  59   FLEQIH-VLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDN 117
Query  118  YLLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKF 152
            +L+  + N  + E   +     R P++  +  E+F
Sbjct  118  FLMAHLINEKDGETFQLMGLYGREPDLSSDIKERF 152

Sequence Alignment: 12. Allergen Name: Fel d 7.0101 Sequence ID: ADK56160

 Score = 46.9 bits 175,  Expect = 4e-07
 Identities = 49/168 29%, Positives = 81/168 48%, Gaps = 10/168 5%
Query  1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE 60
            MK LLLA+ L+             G D   ++G WY  AM     +   +   P  V   
Sbjct  1    MKALLLAVGLSLITVLQAQDPPASGEDTMAMSGKWYLKAMITDRET---SWKKPELVTPM 57
Query  61   ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLD-TDYK-KY 118
             L     G+L+       N +C + ++I EKT  P   K       +V+ ++ T+ K  Y
Sbjct  58   TLTVLEGGNLKAETTLLTNGQCKEVELILEKTSEPK--KYTTYGGKRVVYIEPTEVKDHY 115
Query  119  LLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC 176
            ++ C E   + EQ+ + + + R PE ++EALE F + L+A   +  + F+P Q  + C
Sbjct  116  IFYC-EGEMQGEQARMAKLVGRDPESNEEALENFREFLRAKGFNQEI-FSPKQ-SDTC 170

Sequence Alignment: 13. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 42.6 bits 156,  Expect = 8e-06
 Identities = 45/151 29%, Positives = 63/151 41%, Gaps = 9/151 5%
Query  1    MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE 60
            MK LLL + ++  A          G D   V+G WY  AM A      +    P  V   
Sbjct  1    MKTLLLTIGFSLIAILQAQDTPALGKDTVAVSGKWYLKAMTADQ----EVPEKPDSVTPM 56
Query  61   ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTD--YKKY 118
             LK    G+LE  +    N +C    ++  KT  P   K  A    +V+ +        Y
Sbjct  57   ILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPG--KYTAYEGQRVVFIQPSPVRDHY 114
Query  119  LLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKA 158
            +L C E      Q  + + L R PE   EALE F +  +A
Sbjct  115  ILYC-EGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRA 153

Sequence Alignment: 14. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 35.3 bits 124,  Expect = 0.001
 Identities = 32/85 37%, Positives = 53/85 62%, Gaps = 12/85 14%
Query  1    MKCLLLALAL--TCGA-QALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRV 57
            +K LLLALAL  +C   Q L V+ +       +V G W+SL +AA + S + ++  PLRV
Sbjct  2    VKFLLLALALGVSCAQHQNLEVSPS-------EVDGKWHSLYIAADNKSKV-SEGGPLRV 53
Query  58   YVEELKPTPEGD-LEILLQKWENDECAQKKIIAEKTK 93
            YV+ L+ + E   + I +     + C + +++  K K
Sbjct  54   YVKHLECSDECQTFTIKFYTKVENVCQEHRVVGRKGK 90

Sequence Alignment: 15. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 33.9 bits 118,  Expect = 0.003
 Identities = 27/125 21%, Positives = 57/125 45%, Gaps = 1/125 0%
Query  27   DIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKK 86
            ++ +++G WYS+ +A SD      ++  +RV+VE +       L   ++   N +C +  
Sbjct  16   EVSQISGEWYSVLLA-SDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELF 74
Query  87   IIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLVCMENSAEPEQSLVCQCLVRTPEVDD 146
            +  + T+   V+ ++    N   +LD     Y++  + N    E   + +   R  +V  
Sbjct  75   LTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRS 134
Query  147  EALEKF 152
            +  EKF
Sbjct  135  DIREKF 140

Sequence Alignment: 16. Allergen Name: Bos d 5 Sequence ID: AAA30413

 Score = 29.7 bits 87,  Expect = 0.005
 Identities = 12/14 85%, Positives = 13/14 92%, Gaps = 0/14 0%
Query  125  NSAEPEQSLVCQCL 138
            NSAEP QSLVC+CL
Sbjct  1    NSAEPXQSLVCECL 14

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.