The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA
GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ
FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL
Sequence Info Allergen Name Length Opt Bits Score E Value
P02223 Chi t 6.0201 161 1054 244.2 1.3e-66
P02222 Chi t 3 160 714 167.9 1.2e-43
P02226 Chi t 6.01 145 694 163.5 2.3e-42
P84298 Chi t 7 161 666 157.1 2.1e-40
P84299 Chi t 7 161 666 157.1 2.1e-40
P02224 Chi t 5 162 586 139.2 5.4e-35
P02227 Chi t 8 151 577 137.2 2e-34
P02221 Chi t 2.0101 158 481 115.6 6.5e-28
AAA80190 Chi t 2.0102 158 480 115.4 7.5e-28
P02228 Chi t 9 151 476 114.5 1.3e-27
P02229 Chi t 1.01 151 426 103.3 3.2e-24
P02230 Chi t 1.0201 151 422 102.4 5.9e-24
P02231 Chi t 4 151 251 64.0 2.1e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Chi t 6.0201 Sequence ID: P02223

 Score = 244.2 bits 1054,  Expect = 1e-66
 Identities = 161/161 100%, Positives = 161/161 100%, Gaps = 0/161 0%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA
Sbjct  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ
Sbjct  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL
Sbjct  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161

Sequence Alignment: 2. Allergen Name: Chi t 3 Sequence ID: P02222

 Score = 167.9 bits 714,  Expect = 1e-43
 Identities = 103/160 64%, Positives = 130/160 81%, Gaps = 1/160 0%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKF +VLALCI  A+A P+S+D+A+ +R SWA VKH+EVDIL  +F  +PDI A+FPQFA
Sbjct  1    MKF-LVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFA 59
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDL ++K TG FATHAGRIVGF+SEIVAL+GN +N PAM TLI +++ +H  RGI K Q
Sbjct  60   GKDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQ 119
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            FNEFR+SLVSYL S  SWND+   AWT+GLDN+F M+F++L
Sbjct  120  FNEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160

Sequence Alignment: 3. Allergen Name: Chi t 6.01 Sequence ID: P02226

 Score = 163.5 bits 694,  Expect = 2e-42
 Identities = 98/144 68%, Positives = 127/144 88%, Gaps = 0/144 0%
Query  18   PVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFAGKDLASIKDTGAFATHA 77
            P+S+DQA+ ++++WA V+++EV+ILAAVF+ +PDIQARFPQFAGKD+ASIKDTGAFATHA
Sbjct  2    PLSADQASLVKSTWAQVRNSEVEILAAVFTAYPDIQARFPQFAGKDVASIKDTGAFATHA 61
Query  78   GRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQFNEFRSSLVSYLSSHAS 137
            GRIVGF+SEI+AL+GNESNAPA+ TL+ +L+ SH  RGI++ QFNEFR+ LVSY+SS+ +
Sbjct  62   GRIVGFVSEIIALIGNESNAPAVQTLVGQLAASHKARGISQAQFNEFRAGLVSYVSSNVA 121
Query  138  WNDATADAWTHGLDNIFGMIFAHL 161
            WN A   AWT GLDNIFG++FA L
Sbjct  122  WNAAAESAWTAGLDNIFGLLFAAL 145

Sequence Alignment: 4. Allergen Name: Chi t 7 Sequence ID: P84298

 Score = 157.1 bits 666,  Expect = 2e-40
 Identities = 95/161 59%, Positives = 124/161 77%, Gaps = 0/161 0%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKFF VLALCIVGAIA P+++D+A+ +++SW  V HNEV+ILAAVF+ +PDIQ +F QFA
Sbjct  1    MKFFAVLALCIVGAIASPLTADEASLVQSSWKAVSHNEVEILAAVFAAYPDIQNKFSQFA 60
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDLASIKDTGAFATHA RIV F+SE++AL GN SNA A+ +L+++L   H  RG++  Q
Sbjct  61   GKDLASIKDTGAFATHATRIVSFLSEVIALSGNTSNAAAVNSLVSKLGDDHKARGVSAAQ 120
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            F EFR++LV+YL ++ SW D  A AW   LDN F ++   L
Sbjct  121  FGEFRTALVAYLQANVSWGDNVAAAWNKALDNTFAIVVPRL 161

Sequence Alignment: 5. Allergen Name: Chi t 7 Sequence ID: P84299

 Score = 157.1 bits 666,  Expect = 2e-40
 Identities = 95/161 59%, Positives = 124/161 77%, Gaps = 0/161 0%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKFF VLALCIVGAIA P+++D+A+ +++SW  V HNEV+ILAAVF+ +PDIQ +F QFA
Sbjct  1    MKFFAVLALCIVGAIASPLTADEASLVQSSWKAVSHNEVEILAAVFAAYPDIQNKFSQFA 60
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDLASIKDTGAFATHA RIV F+SE++AL GN SNA A+ +L+++L   H  RG++  Q
Sbjct  61   GKDLASIKDTGAFATHATRIVSFLSEVIALSGNTSNAAAVNSLVSKLGDDHKARGVSAAQ 120
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            F EFR++LV+YL ++ SW D  A AW   LDN F ++   L
Sbjct  121  FGEFRTALVAYLQANVSWGDNVAAAWNKALDNTFAIVVPRL 161

Sequence Alignment: 6. Allergen Name: Chi t 5 Sequence ID: P02224

 Score = 139.2 bits 586,  Expect = 5e-35
 Identities = 85/160 53%, Positives = 120/160 75%, Gaps = 1/160 0%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKF +VLALCI  A A  ++++QA+ ++ +W+ VK NEVDIL AVF  +PDI A+FPQFA
Sbjct  1    MKF-LVLALCIAAASAAVLTTEQADLVKKTWSTVKFNEVDILYAVFKAYPDIMAKFPQFA 59
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDL SIKD+ AFATHA RIV F+SE+++L G+++N PA+  L  EL+TSH  RG++K Q
Sbjct  60   GKDLDSIKDSAAFATHATRIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQ 119
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            F EFR++L +YL +H +++  T  AWT  LD  + M+F+ +
Sbjct  120  FTEFRTALFTYLKAHINFDGPTETAWTLALDTTYAMLFSAM 160

Sequence Alignment: 7. Allergen Name: Chi t 8 Sequence ID: P02227

 Score = 137.2 bits 577,  Expect = 2e-34
 Identities = 84/144 58%, Positives = 103/144 71%, Gaps = 0/144 0%
Query  18   PVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFAGKDLASIKDTGAFATHA 77
            P+S+DQ    ++SW  VKHNEVDIL AVF  +PDIQA+FPQFAGKDL SIKD+  FA H+
Sbjct  4    PMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHS 63
Query  78   GRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQFNEFRSSLVSYLSSHAS 137
            GRIVGF SE++ L+GN  N PA+ TLI+ L++SH  RGI K QF EFR+SLV YLS H  
Sbjct  64   GRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLD 123
Query  138  WNDATADAWTHGLDNIFGMIFAHL 161
            WND     W   L+N+F  I+  L
Sbjct  124  WNDTMKSTWDLALNNMFFYILHAL 147

Sequence Alignment: 8. Allergen Name: Chi t 2.0101 Sequence ID: P02221

 Score = 115.6 bits 481,  Expect = 6e-28
 Identities = 74/154 48%, Positives = 101/154 65%, Gaps = 3/154 1%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKF ++LALC+  A+A P S DQ  A +ASW  VK+N+VDIL AVF  +PDIQ  F QFA
Sbjct  1    MKF-LILALCVAAAMAGP-SGDQIAAAKASWNTVKNNQVDILYAVFKANPDIQTAFSQFA 58
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDL SIK T  F+ HAGR+VG+ SE++ L+GN++N P +     ++  SH +R  +  Q
Sbjct  59   GKDLDSIKGTPDFSKHAGRVVGLFSEVMDLLGNDANTPTILAKAKDFGKSHKSRA-SPAQ 117
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMI 157
            ++ FR SLV YL     W+ A   +W   LD +F  +
Sbjct  118  LDNFRKSLVVYLKGATKWDSAVESSWAPVLDFVFSTL 154

Sequence Alignment: 9. Allergen Name: Chi t 2.0102 Sequence ID: AAA80190

 Score = 115.4 bits 480,  Expect = 8e-28
 Identities = 74/154 48%, Positives = 101/154 65%, Gaps = 3/154 1%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKF ++LALC+  A+A P S DQ  A +ASW  VK+N+VDIL AVF  +PDIQ  F QFA
Sbjct  1    MKF-LILALCVAAAMAGP-SGDQIAAAKASWNTVKNNQVDILYAVFKANPDIQTAFSQFA 58
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDL SIK T  F+ HAGR+VG+ SE++ L+GN++N P +     ++  SH +R  +  Q
Sbjct  59   GKDLDSIKGTPDFSKHAGRVVGLFSEVMDLLGNDANTPTILAKAKDFGKSHKSR-TSPAQ 117
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMI 157
            ++ FR SLV YL     W+ A   +W   LD +F  +
Sbjct  118  LDNFRKSLVVYLKGATKWDSAVESSWAPVLDFVFSTL 154

Sequence Alignment: 10. Allergen Name: Chi t 9 Sequence ID: P02228

 Score = 114.5 bits 476,  Expect = 1e-27
 Identities = 65/140 46%, Positives = 90/140 64%, Gaps = 0/140 0%
Query  19   VSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFAGKDLASIKDTGAFATHAG 78
            + + +   ++A+W  V H+EV+IL  VF  HPDI A+FP+FAGKDL +IKDT  FA HA 
Sbjct  7    LDAHEVEQVQATWKAVSHDEVEILYTVFKAHPDIMAKFPKFAGKDLEAIKDTADFAVHAS 66
Query  79   RIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQFNEFRSSLVSYLSSHASW 138
            RI+GF  E V L+G+  N  A+ TL+++L   H  RGITK QF EFR ++ +YL  H  W
Sbjct  67   RIIGFFGEYVTLLGSSGNQAAIRTLLHDLGVFHKTRGITKAQFGEFRETMTAYLKGHNKW 126
Query  139  NDATADAWTHGLDNIFGMIF 158
            N   + +W   +D  F +IF
Sbjct  127  NADISHSWDDAFDKAFSVIF 146

Sequence Alignment: 11. Allergen Name: Chi t 1.01 Sequence ID: P02229

 Score = 103.3 bits 426,  Expect = 3e-24
 Identities = 74/151 49%, Positives = 98/151 64%, Gaps = 10/151 6%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MKF+I LALC   A A  +S+DQ + ++AS+  VK + V IL AVF   P I A+F QFA
Sbjct  1    MKFLI-LALCF--AAASALSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFA 57
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDL SIK T  F  HA RIVGF S+I+  +      P +   +N +  SH  RG+T  Q
Sbjct  58   GKDLESIKGTAPFEIHANRIVGFFSKIIGEL------PNIEADVNTFVASHKPRGVTHDQ 111
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            +N FR+ +VSY+ +H  +  A A AW   LD  FGMIF+ +
Sbjct  112  LNNFRAGFVSYMKAHTDFAGAEA-AWGATLDTFFGMIFSKM 151

Sequence Alignment: 12. Allergen Name: Chi t 1.0201 Sequence ID: P02230

 Score = 102.4 bits 422,  Expect = 6e-24
 Identities = 71/151 47%, Positives = 101/151 66%, Gaps = 10/151 6%
Query  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
            MK++I LALC   A A  +++DQ + +++S+AGVK + V IL AVF   P IQA+F QFA
Sbjct  1    MKLLI-LALCF--AAASALTADQISTVQSSFAGVKGDAVGILYAVFKADPSIQAKFTQFA 57
Query  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
            GKDL SIK +  F+ HA +IVGF S+I+       + P +   +  +  SH  RG+T  Q
Sbjct  58   GKDLDSIKGSADFSAHANKIVGFFSKIIG------DLPNIDGDVTTFVASHTPRGVTHDQ 111
Query  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
            +N FR+ +VSY+ +H  +  A A AW   LD  FGM+FA +
Sbjct  112  LNNFRAGFVSYMKAHTDFAGAEA-AWGATLDAFFGMVFAKM 151

Sequence Alignment: 13. Allergen Name: Chi t 4 Sequence ID: P02231

 Score = 64.0 bits 251,  Expect = 2e-12
 Identities = 50/143 34%, Positives = 76/143 53%, Gaps = 10/143 6%
Query  12   VGAIADPVSSD-QANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA--GKDLASIK 68
            V   A P  +D Q  A++  W  +K + V+IL   ++  P     FP F   G DLA+ K
Sbjct  1    VATPAMPSMTDAQVAAVKGDWEKIKGSGVEILYFFLNKFP---GNFPMFKKLGNDLAAAK 57
Query  69   DTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQFNEFRSSL 128
             T  F  +A +I+ F+  ++  +G  S+      L+N+L TSH   GITK QF++FR +L
Sbjct  58   GTAEFKDQADKIIAFLQGVIEKLG--SDMGGAKALLNQLGTSHKAMGITKDQFDQFRQAL 115
Query  129  VSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161
               L +          AW   +D +F +IF  L
Sbjct  116  TELLGNLGF--GGNIGAWNATVDLMFHVIFNAL 146

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.