The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT
GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA
LQKRVQDSE
Sequence Info Allergen Name Length Opt Bits Score E Value
ABH06347 Blo t 21.0101 129 816 193.4 1.6e-51
ABH06344 Blo t 21.0101 129 811 192.3 3.5e-51
ABH06348 Blo t 21.0101 129 810 192.1 4.1e-51
ABH06350 Blo t 21.0101 129 806 191.1 7.8e-51
ABH06346 Blo t 21.0101 129 802 190.2 1.5e-50
Q9U5P2 Lep d 5.0101 110 358 89.2 3.3e-20
AAQ73493 Lep d 5.0102 171 362 89.8 3.4e-20
AAQ73494 Lep d 5.0103 169 360 89.3 4.6e-20
O96870 Blo t 5 134 340 84.9 7.8e-19
B2GM84 Der f 21.0101 136 323 81.0 1.2e-17
ABC73706 Der p 21.0101 140 311 78.3 8.1e-17
ABO84970 Der f 5.0101 132 297 75.1 6.8e-16
P14004 Der p 5.0102 132 250 64.4 1.1e-12
CAA35692 Der p 5.0101 148 250 64.3 1.4e-12
AAB32842 Der p 5.0102 132 248 63.9 1.6e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 21.0101 Sequence ID: ABH06347

 Score = 193.4 bits 816,  Expect = 2e-51
 Identities = 129/129 100%, Positives = 129/129 100%, Gaps = 0/129 0%
Query  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT 60
            MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT 60
Query  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
            GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA
Sbjct  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
Query  121  LQKRVQDSE 129
            LQKRVQDSE
Sbjct  121  LQKRVQDSE 129

Sequence Alignment: 2. Allergen Name: Blo t 21.0101 Sequence ID: ABH06344

 Score = 192.3 bits 811,  Expect = 4e-51
 Identities = 128/129 99%, Positives = 128/129 99%, Gaps = 0/129 0%
Query  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT 60
            MKFIIALAALIAVACALPVSNDNFRHEFDHMIVN ATQRFHEIEKFLLHITHEVDDLEKT
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKT 60
Query  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
            GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA
Sbjct  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
Query  121  LQKRVQDSE 129
            LQKRVQDSE
Sbjct  121  LQKRVQDSE 129

Sequence Alignment: 3. Allergen Name: Blo t 21.0101 Sequence ID: ABH06348

 Score = 192.1 bits 810,  Expect = 4e-51
 Identities = 127/129 98%, Positives = 128/129 99%, Gaps = 0/129 0%
Query  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT 60
            MKFIIALAALIAVACALPVSNDNFRHEFDHMI+N ATQRFHEIEKFLLHITHEVDDLEKT
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIINTATQRFHEIEKFLLHITHEVDDLEKT 60
Query  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
            GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA
Sbjct  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
Query  121  LQKRVQDSE 129
            LQKRVQDSE
Sbjct  121  LQKRVQDSE 129

Sequence Alignment: 4. Allergen Name: Blo t 21.0101 Sequence ID: ABH06350

 Score = 191.1 bits 806,  Expect = 8e-51
 Identities = 127/129 98%, Positives = 128/129 99%, Gaps = 0/129 0%
Query  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT 60
            MKFIIALAALIAVACALPVSNDNFRHEFDHMIVN ATQRFHEIEKFLLHITHEVDDLE+T
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEET 60
Query  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
            GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA
Sbjct  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
Query  121  LQKRVQDSE 129
            LQKRVQDSE
Sbjct  121  LQKRVQDSE 129

Sequence Alignment: 5. Allergen Name: Blo t 21.0101 Sequence ID: ABH06346

 Score = 190.2 bits 802,  Expect = 1e-50
 Identities = 127/129 98%, Positives = 127/129 98%, Gaps = 0/129 0%
Query  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKT 60
            MKFIIALAALIAVACALPVSNDNFRHEFDHMIVN ATQRFHEIEKFLLHITHEVDDLEKT
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKT 60
Query  61   GNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
            GNKDEKAR LRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA
Sbjct  61   GNKDEKARPLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKA 120
Query  121  LQKRVQDSE 129
            LQKRVQDSE
Sbjct  121  LQKRVQDSE 129

Sequence Alignment: 6. Allergen Name: Lep d 5.0101 Sequence ID: Q9U5P2

 Score = 89.2 bits 358,  Expect = 3e-20
 Identities = 51/108 47%, Positives = 85/108 78%, Gaps = 0/108 0%
Query  22   DNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIE 81
            D+FR+EFD ++++   ++F ++E+ L H++H+V +LEK+ +K+ KA++LRE+++   FI+
Sbjct  1    DDFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFID 60
Query  82   GSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE 129
             ++G+F+RELKR DL+L EKFNFE+AL+TG +L KDL AL  +V+  E
Sbjct  61   SAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIE 108

Sequence Alignment: 7. Allergen Name: Lep d 5.0102 Sequence ID: AAQ73493

 Score = 89.8 bits 362,  Expect = 3e-20
 Identities = 54/116 46%, Positives = 89/116 76%, Gaps = 1/116 0%
Query  13   VACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRE 72
            V  A+P + D FR+EFD ++++   ++F ++E+ L H++H+V +LEK+ +K+ KA++LRE
Sbjct  54   VDVAIP-NPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILRE 112
Query  73   LTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE 129
            +++   FI+ ++G+F+RELKR DL+L EKFNFE+AL+TG +L KDL AL  +V+  E
Sbjct  113  ISIGLDFIDSAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIE 169
 Score = 38.5 bits 137,  Expect = 9e-05
 Identities = 22/50 44%, Positives = 36/50 72%, Gaps = 0/50 0%
Query  80   IEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE 129
            + G + +++ ELKRTDL++LEKFN++   AT ++L K+L  +QK V+  E
Sbjct  1    MTGVKTHLEHELKRTDLNFLEKFNLDEITATLNVLTKELTEVQKHVKAVE 50

Sequence Alignment: 8. Allergen Name: Lep d 5.0103 Sequence ID: AAQ73494

 Score = 89.3 bits 360,  Expect = 5e-20
 Identities = 53/113 46%, Positives = 88/113 77%, Gaps = 1/113 0%
Query  16   ALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTV 75
            A+P + D FR+EFD ++++   ++F ++E+ L H++H+V +LEK+ +K+ KA++LRE+++
Sbjct  55   AIP-NPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISI 113
Query  76   SEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE 129
               FI+ ++G+F+RELKR DL+L EKFNFE+AL+TG +L KDL AL  +V+  E
Sbjct  114  GLDFIDSAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIE 167
 Score = 38.3 bits 136,  Expect = 0.0001
 Identities = 22/50 44%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  80   IEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE 129
            + G + ++Q ELKRTDL++LEKFN++   A  ++L K+L  +QK V+  E
Sbjct  1    MTGVKTHLQHELKRTDLNFLEKFNLDEITAPLNVLTKELTEVQKHVKAVE 50

Sequence Alignment: 9. Allergen Name: Blo t 5 Sequence ID: O96870

 Score = 84.9 bits 340,  Expect = 8e-19
 Identities = 54/127 42%, Positives = 87/127 68%, Gaps = 3/127 2%
Query  1    MKFIIALAALIA---VACALPVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDL 57
            MKF I L A  A   +A       D+FR+EFDH+++  A +   + E  LL++ H++D+L
Sbjct  1    MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDEL 60
Query  58   EKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKD 117
             +  +K+ + +++REL V  A IEG++G ++RELKRTDL++LE+FN+E A     +LLKD
Sbjct  61   NENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKD 120
Query  118  LKALQKRVQD 127
            LK  +++V+D
Sbjct  121  LKETEQKVKD 130

Sequence Alignment: 10. Allergen Name: Der f 21.0101 Sequence ID: B2GM84

 Score = 81.0 bits 323,  Expect = 1e-17
 Identities = 51/126 40%, Positives = 91/126 72%, Gaps = 4/126 3%
Query  1    MKFIIALAALIAVACALPV----SNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDD 56
            MKFII  A ++AV+ +  +    + D +R+ FDHM++    ++  +IE  LL ++ +  +
Sbjct  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
Query  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
            LEKT +K+ K ++LRELT++E ++ G+  + Q+E KRTDL+++E++NFE A++T ++L+K
Sbjct  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
Query  117  DLKALQKRVQ 126
            DL  L K+V+
Sbjct  121  DLAELAKKVK 130

Sequence Alignment: 11. Allergen Name: Der p 21.0101 Sequence ID: ABC73706

 Score = 78.3 bits 311,  Expect = 8e-17
 Identities = 53/126 42%, Positives = 87/126 69%, Gaps = 6/126 4%
Query  1    MKFIIALAALIAVACALP---VSN---DNFRHEFDHMIVNAATQRFHEIEKFLLHITHEV 54
            MKFII L A I +A A+    V +   D +R  FD +++     +  ++EK LLH++ + 
Sbjct  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
Query  55   DDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLL 114
             +LEKT +K+ K ++LRELT+ E F++G+  +F+ E KRTDL+++E++N+E AL +  LL
Sbjct  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
Query  115  LKDLKALQKRVQ 126
            +K L  L K+V+
Sbjct  121  IKKLDELAKKVK 132

Sequence Alignment: 12. Allergen Name: Der f 5.0101 Sequence ID: ABO84970

 Score = 75.1 bits 297,  Expect = 7e-16
 Identities = 49/128 38%, Positives = 87/128 67%, Gaps = 4/128 3%
Query  1    MKFIIALAA-LIAVACAL--PVSNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDDL 57
            MKFIIA+A   +AV C    P  +D +++EFD +++    ++  + E+ LLH+ H+++ +
Sbjct  1    MKFIIAIAVCTLAVVCVSGEPKKHD-YQNEFDFLLMQRIHEQMRKGEEALLHLQHQINTF 59
Query  58   EKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKD 117
            E+   K+ K ++L E+    A+I+G RG + R +KRTDLD++E++N E AL + ++L +D
Sbjct  60   EENPTKEMKEQILGEMDTIIALIDGVRGVLNRLMKRTDLDIFERYNVEIALKSNEILERD 119
Query  118  LKALQKRVQDSE 129
            LK  ++RV+  E
Sbjct  120  LKKEEQRVKKIE 131

Sequence Alignment: 13. Allergen Name: Der p 5.0102 Sequence ID: P14004

 Score = 64.4 bits 250,  Expect = 1e-12
 Identities = 42/127 33%, Positives = 82/127 64%, Gaps = 6/127 4%
Query  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNAATQRFHEIEKFLLHITHEVDD 56
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 58
Query  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
            +E+   K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  59   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 118
Query  117  DLKALQKRVQDSE 129
            DLK  + RV+  E
Sbjct  119  DLKKEEARVKKIE 131

Sequence Alignment: 14. Allergen Name: Der p 5.0101 Sequence ID: CAA35692

 Score = 64.3 bits 250,  Expect = 1e-12
 Identities = 42/127 33%, Positives = 82/127 64%, Gaps = 6/127 4%
Query  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNAATQRFHEIEKFLLHITHEVDD 56
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  17   MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 74
Query  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
            +E+   K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  75   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 134
Query  117  DLKALQKRVQDSE 129
            DLK  + RV+  E
Sbjct  135  DLKKEEARVKKIE 147

Sequence Alignment: 15. Allergen Name: Der p 5.0102 Sequence ID: AAB32842

 Score = 63.9 bits 248,  Expect = 2e-12
 Identities = 42/127 33%, Positives = 81/127 63%, Gaps = 6/127 4%
Query  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNAATQRFHEIEKFLLHITHEVDD 56
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 58
Query  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
            +E    K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  59   FEAKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 118
Query  117  DLKALQKRVQDSE 129
            DLK  + RV+  E
Sbjct  119  DLKKEEARVKKIE 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.