The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE
LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK
DLAELAKKVKAVKSDD
Sequence Info Allergen Name Length Opt Bits Score E Value
B2GM84 Der f 21.0101 136 854 184.0 1.2e-48
ABC73706 Der p 21.0101 140 615 135.0 7.3e-34
AAQ73493 Lep d 5.0102 171 339 78.3 1e-16
AAQ73494 Lep d 5.0103 169 337 77.9 1.4e-16
Q9U5P2 Lep d 5.0101 110 330 76.5 2.2e-16
O96870 Blo t 5 134 330 76.5 2.8e-16
ABH06348 Blo t 21.0101 129 324 75.3 6.3e-16
ABH06344 Blo t 21.0101 129 323 75.0 7.3e-16
ABH06347 Blo t 21.0101 129 323 75.0 7.3e-16
ABH06350 Blo t 21.0101 129 318 74.0 1.5e-15
ABH06346 Blo t 21.0101 129 318 74.0 1.5e-15
ABO84970 Der f 5.0101 132 274 65.0 8e-13
P14004 Der p 5.0102 132 251 60.3 2.1e-11
CAA35692 Der p 5.0101 148 251 60.2 2.4e-11
AAB32842 Der p 5.0102 132 249 59.9 2.8e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 21.0101 Sequence ID: B2GM84

 Score = 184.0 bits 854,  Expect = 1e-48
 Identities = 136/136 100%, Positives = 136/136 100%, Gaps = 0/136 0%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE
Sbjct  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK
Sbjct  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
Query  121  DLAELAKKVKAVKSDD 136
            DLAELAKKVKAVKSDD
Sbjct  121  DLAELAKKVKAVKSDD 136

Sequence Alignment: 2. Allergen Name: Der p 21.0101 Sequence ID: ABC73706

 Score = 135.0 bits 615,  Expect = 7e-34
 Identities = 98/136 72%, Positives = 116/136 85%, Gaps = 2/136 1%
Query  1    MKFII--FCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
            MKFII  F AIVMA +VSGFIV    ED+WR AFD ++MEE+E K+DQ+E GLL LSEQY
Sbjct  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
Query  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
            KELEKTKSKELKEQILRELTI EN+++GALKF + EAKRTDLNMFERYN+E A+ +I++L
Sbjct  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
Query  119  VKDLAELAKKVKAVKSDD 136
            +K L ELAKKVKAV  D+
Sbjct  121  IKKLDELAKKVKAVNPDE 138

Sequence Alignment: 3. Allergen Name: Lep d 5.0102 Sequence ID: AAQ73493

 Score = 78.3 bits 339,  Expect = 1e-16
 Identities = 57/125 45%, Positives = 83/125 66%, Gaps = 0/125 0%
Query  10   VMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKEL 69
            V AV      V +   D++RN FD +L+   EE+  ++E+ L  LS Q  ELEK+KSKEL
Sbjct  46   VKAVESDEVDVAIPNPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKEL 105
Query  70   KEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKV 129
            K QILRE++I  +++  A    ++E KR DLN+ E++NFE+A+ST  +L KDL  LA KV
Sbjct  106  KAQILREISIGLDFIDSAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKV 165
Query  130  KAVKS 134
            KA+++
Sbjct  166  KAIET 170

Sequence Alignment: 4. Allergen Name: Lep d 5.0103 Sequence ID: AAQ73494

 Score = 77.9 bits 337,  Expect = 1e-16
 Identities = 54/115 46%, Positives = 80/115 69%, Gaps = 0/115 0%
Query  20   VDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTI 79
            V +   D++RN FD +L+   EE+  ++E+ L  LS Q  ELEK+KSKELK QILRE++I
Sbjct  54   VAIPNPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISI 113
Query  80   AENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKS 134
              +++  A    ++E KR DLN+ E++NFE+A+ST  +L KDL  LA KVKA+++
Sbjct  114  GLDFIDSAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIET 168
 Score = 40.1 bits 153,  Expect = 3e-05
 Identities = 22/53 41%, Positives = 37/53 69%, Gaps = 0/53 0%
Query  84   LRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKSDD 136
            + G    +Q+E KRTDLN +E++N++   + + +L K+L E+ K VKAV+SD+
Sbjct  1    MTGVKTHLQHELKRTDLNFLEKFNLDEITAPLNVLTKELTEVQKHVKAVESDE 53

Sequence Alignment: 5. Allergen Name: Lep d 5.0101 Sequence ID: Q9U5P2

 Score = 76.5 bits 330,  Expect = 2e-16
 Identities = 53/109 48%, Positives = 77/109 70%, Gaps = 0/109 0%
Query  26   DKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLR 85
            D +RN FD +L+   EE+  ++E+ L  LS Q  ELEK+KSKELK QILRE++I  +++ 
Sbjct  1    DDFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFID 60
Query  86   GALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKS 134
             A    ++E KR DLN+ E++NFE+A+ST  +L KDL  LA KVKA+++
Sbjct  61   SAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIET 109

Sequence Alignment: 6. Allergen Name: Blo t 5 Sequence ID: O96870

 Score = 76.5 bits 330,  Expect = 3e-16
 Identities = 56/133 42%, Positives = 84/133 63%, Gaps = 1/133 0%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKF I      A SV         +D +RN FDH+L+E+    +++ EH LL L  Q  E
Sbjct  1    MKFAIVLIACFAASVLA-QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDE 59
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            L + KSKEL+E+I+REL +    + GA   +++E KRTDLN++ER+N+E A +  +IL+K
Sbjct  60   LNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLK 119
Query  121  DLAELAKKVKAVKS 134
            DL E  +KVK +++
Sbjct  120  DLKETEQKVKDIQT 133

Sequence Alignment: 7. Allergen Name: Blo t 21.0101 Sequence ID: ABH06348

 Score = 75.3 bits 324,  Expect = 6e-16
 Identities = 51/126 40%, Positives = 91/126 72%, Gaps = 4/126 3%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKFII  A ++AV+ +  +    + D +R+ FDHM++    ++  +IE  LL ++ +  +
Sbjct  1    MKFIIALAALIAVACALPV----SNDNFRHEFDHMIINTATQRFHEIEKFLLHITHEVDD 56
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            LEKT +K+ K ++LRELT++E ++ G+  + Q+E KRTDL+++E++NFE A++T ++L+K
Sbjct  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  121  DLAELAKKVK 130
            DL  L K+V+
Sbjct  117  DLKALQKRVQ 126

Sequence Alignment: 8. Allergen Name: Blo t 21.0101 Sequence ID: ABH06344

 Score = 75.0 bits 323,  Expect = 7e-16
 Identities = 51/126 40%, Positives = 91/126 72%, Gaps = 4/126 3%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKFII  A ++AV+ +  +    + D +R+ FDHM++    ++  +IE  LL ++ +  +
Sbjct  1    MKFIIALAALIAVACALPV----SNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDD 56
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            LEKT +K+ K ++LRELT++E ++ G+  + Q+E KRTDL+++E++NFE A++T ++L+K
Sbjct  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  121  DLAELAKKVK 130
            DL  L K+V+
Sbjct  117  DLKALQKRVQ 126

Sequence Alignment: 9. Allergen Name: Blo t 21.0101 Sequence ID: ABH06347

 Score = 75.0 bits 323,  Expect = 7e-16
 Identities = 51/126 40%, Positives = 91/126 72%, Gaps = 4/126 3%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKFII  A ++AV+ +  +    + D +R+ FDHM++    ++  +IE  LL ++ +  +
Sbjct  1    MKFIIALAALIAVACALPV----SNDNFRHEFDHMIVNAATQRFHEIEKFLLHITHEVDD 56
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            LEKT +K+ K ++LRELT++E ++ G+  + Q+E KRTDL+++E++NFE A++T ++L+K
Sbjct  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  121  DLAELAKKVK 130
            DL  L K+V+
Sbjct  117  DLKALQKRVQ 126

Sequence Alignment: 10. Allergen Name: Blo t 21.0101 Sequence ID: ABH06350

 Score = 74.0 bits 318,  Expect = 1e-15
 Identities = 50/126 39%, Positives = 91/126 72%, Gaps = 4/126 3%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKFII  A ++AV+ +  +    + D +R+ FDHM++    ++  +IE  LL ++ +  +
Sbjct  1    MKFIIALAALIAVACALPV----SNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDD 56
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            LE+T +K+ K ++LRELT++E ++ G+  + Q+E KRTDL+++E++NFE A++T ++L+K
Sbjct  57   LEETGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  121  DLAELAKKVK 130
            DL  L K+V+
Sbjct  117  DLKALQKRVQ 126

Sequence Alignment: 11. Allergen Name: Blo t 21.0101 Sequence ID: ABH06346

 Score = 74.0 bits 318,  Expect = 1e-15
 Identities = 51/126 40%, Positives = 90/126 71%, Gaps = 4/126 3%
Query  1    MKFIIFCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKE 60
            MKFII  A ++AV+ +  +    + D +R+ FDHM++    ++  +IE  LL ++ +  +
Sbjct  1    MKFIIALAALIAVACALPV----SNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDD 56
Query  61   LEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVK 120
            LEKT +K+ K + LRELT++E ++ G+  + Q+E KRTDL+++E++NFE A++T ++L+K
Sbjct  57   LEKTGNKDEKARPLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  121  DLAELAKKVK 130
            DL  L K+V+
Sbjct  117  DLKALQKRVQ 126

Sequence Alignment: 12. Allergen Name: Der f 5.0101 Sequence ID: ABO84970

 Score = 65.0 bits 274,  Expect = 8e-13
 Identities = 52/129 40%, Positives = 79/129 61%, Gaps = 6/129 4%
Query  1    MKFIIFCAI--VMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
            MKFII  A+  +  V VSG   +    D ++N FD +LM+   E+M + E  LL L  Q 
Sbjct  1    MKFIIAIAVCTLAVVCVSG---EPKKHD-YQNEFDFLLMQRIHEQMRKGEEALLHLQHQI 56
Query  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
              +E+  +KE+KEQIL E+      + G    + +  KRTDL++FERYN E A+ + EIL
Sbjct  57   NTFEENPTKEMKEQILGEMDTIIALIDGVRGVLNRLMKRTDLDIFERYNVEIALKSNEIL 116
Query  119  VKDLAELAKKVKAVK 133
             +DL +  ++VK ++
Sbjct  117  ERDLKKEEQRVKKIE 131

Sequence Alignment: 13. Allergen Name: Der p 5.0102 Sequence ID: P14004

 Score = 60.3 bits 251,  Expect = 2e-11
 Identities = 45/129 34%, Positives = 79/129 61%, Gaps = 6/129 4%
Query  1    MKFII--FCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
            MKFII  F A +  ++VSG     D +  ++N FD +LME   E++ + E  L+ L EQ 
Sbjct  1    MKFIIAFFVATLAVMTVSGE----DKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQI 56
Query  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
              +E+  +KE+K++I+ E+      + G    + +  +R DL++FE+YN+E A  + +IL
Sbjct  57   NHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 116
Query  119  VKDLAELAKKVKAVK 133
             +DL +   +VK ++
Sbjct  117  ERDLKKEEARVKKIE 131

Sequence Alignment: 14. Allergen Name: Der p 5.0101 Sequence ID: CAA35692

 Score = 60.2 bits 251,  Expect = 2e-11
 Identities = 45/129 34%, Positives = 79/129 61%, Gaps = 6/129 4%
Query  1    MKFII--FCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
            MKFII  F A +  ++VSG     D +  ++N FD +LME   E++ + E  L+ L EQ 
Sbjct  17   MKFIIAFFVATLAVMTVSGE----DKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQI 72
Query  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
              +E+  +KE+K++I+ E+      + G    + +  +R DL++FE+YN+E A  + +IL
Sbjct  73   NHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 132
Query  119  VKDLAELAKKVKAVK 133
             +DL +   +VK ++
Sbjct  133  ERDLKKEEARVKKIE 147

Sequence Alignment: 15. Allergen Name: Der p 5.0102 Sequence ID: AAB32842

 Score = 59.9 bits 249,  Expect = 3e-11
 Identities = 45/129 34%, Positives = 78/129 60%, Gaps = 6/129 4%
Query  1    MKFII--FCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
            MKFII  F A +  ++VSG     D +  ++N FD +LME   E++ + E  L+ L EQ 
Sbjct  1    MKFIIAFFVATLAVMTVSGE----DKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQI 56
Query  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
              +E   +KE+K++I+ E+      + G    + +  +R DL++FE+YN+E A  + +IL
Sbjct  57   NHFEAKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 116
Query  119  VKDLAELAKKVKAVK 133
             +DL +   +VK ++
Sbjct  117  ERDLKKEEARVKKIE 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.