The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE
EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWR
QKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCN
GCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLRYQSSDEDV
MYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIR
NSWGTGWGNGGYGYVERGHNSLGINNFVTYATL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAQ24541 Blo t 1.0201 333 2302 624.7 1.6e-180
AAK58415 Blo t 1.0101 221 1033 283.9 4e-78
ABM53753 Tyr p 1.0101 336 802 221.6 3.6e-59
P00785 Act d 1 380 635 176.6 1.4e-45
AAA32629 Act d 1 380 631 175.5 3e-45
P08176 Der p 1 320 563 157.4 7.3e-40
CAQ68250 Der p 1.0124 302 547 153.1 1.3e-38
AAB09252 Gly m 1 379 542 151.6 4.7e-38
P22895 Gly m 1 379 541 151.4 5.6e-38
ABA39435 Der p 1.0113 302 536 150.2 1e-37
AAC82352 Eur m 1.0102 321 523 146.6 1.3e-36
AAC82351 Eur m 1.0101 321 522 146.4 1.5e-36
P25780 Eur m 1.0101 321 522 146.4 1.5e-36
2428875 Der f 1.0103 303 519 145.6 2.4e-36
2428875 Der f 1.0102 303 515 144.5 5.1e-36
ABL84751 Der f 1.0110 321 515 144.5 5.6e-36
2428875 Der f 1.0105 303 512 143.7 9e-36
BAC53948 Der f 1.0101 321 511 143.4 1.2e-35
2428875 Der f 1.0107 303 509 142.9 1.6e-35
ABL84749 Der f 1.0108 321 508 142.6 2.1e-35
ABL84750 Der f 1.0109 321 506 142.1 3e-35
P16311 Der f 1 321 500 140.5 9.1e-35
2428875 Der f 1.0104 303 493 138.6 3.1e-34
CAA42677 Eur m 1.0101 211 489 137.8 3.8e-34
CAA46316 Der f 1 212 483 136.2 1.2e-33
BAA21849 Ana c 2 351 465 131.0 7.1e-32
AAB02650 Car p papain 345 439 124.0 8.7e-30
6771329 Der p 1.0122 222 424 120.3 7.5e-29
6771329 Der p 1.0120 222 422 119.7 1.1e-28
6771329 Der p 1.0117 222 422 119.7 1.1e-28
6771329 Der p 1.0123 222 422 119.7 1.1e-28
6771329 Der p 1.0115 222 422 119.7 1.1e-28
6771329 Der p 1.0118 222 421 119.5 1.3e-28
6771329 Der p 1.0114 222 420 119.2 1.6e-28
6771329 Der p 1.0121 222 420 119.2 1.6e-28
6771329 Der p 1.0119 222 417 118.4 2.8e-28
6771329 Der p 1.0116 222 413 117.3 5.8e-28
P14080 Cari p 2.0101 352 403 114.3 7.4e-27
V5LU01 Amb a 11.0101 386 335 96.0 2.7e-21
AAA28296 Der p 1 96 225 67.4 2.7e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 624.7 bits 2302,  Expect = 2e-180
 Identities = 333/333 100%, Positives = 333/333 100%, Gaps = 0/333 0%
Query  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
            MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE
Sbjct  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
Query  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWR 120
            EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWR
Sbjct  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWR 120
Query  121  QKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCN 180
            QKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCN
Sbjct  121  QKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCN 180
Query  181  GCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLRYQSSDEDV 240
            GCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLRYQSSDEDV
Sbjct  181  GCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLRYQSSDEDV 240
Query  241  MYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIR 300
            MYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIR
Sbjct  241  MYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIR 300
Query  301  NSWGTGWGNGGYGYVERGHNSLGINNFVTYATL 333
            NSWGTGWGNGGYGYVERGHNSLGINNFVTYATL
Sbjct  301  NSWGTGWGNGGYGYVERGHNSLGINNFVTYATL 333

Sequence Alignment: 2. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 283.9 bits 1033,  Expect = 4e-78
 Identities = 135/221 61%, Positives = 170/221 76%, Gaps = 0/221 0%
Query  113  LPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNR 172
            +P NFDWRQK  +  IR QG CGSCWAFAA+ VAE+LY+I+++Q+I LSEQEL+DCTY+ 
Sbjct  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
Query  173  YDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLR 232
            YD +Y+C+GC SG S EAFKYM + GL+EE +YPY M+   C  +  G RYHVS Y  LR
Sbjct  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
Query  233  YQSSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQ 292
            Y++ D+++   I  HGPVVIY+HG+  +FRNL  G+LRG  YNDA  DHAV+LVGWGT  
Sbjct  121  YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN 180
Query  293  GVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNFVTYATL 333
            G+DYWI+R SWGT WG+ GYG+VER HNSLGINN+  YA+L
Sbjct  181  GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221

Sequence Alignment: 3. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 221.6 bits 802,  Expect = 4e-59
 Identities = 132/325 40%, Positives = 197/325 60%, Gaps = 14/325 4%
Query  4    LLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHN 63
            LL   L  +     C+   E++ T+EQ+K  FGK Y    EE  R++++   L  + ++N
Sbjct  3    LLFYILFLFFTFIQCRHL-EKVPTWEQYKVKFGKNYLTINEENFRKNNYFNSLTKIVKNN 61
Query  64   GIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWRQKA 123
            G +GV   +N+ SD S++EF F L+    +  ++   A     +NT   +P+++DWR   
Sbjct  62   GKNGVTLGLNDMSDWSDEEF-FSLNSKSPSSVFVS--ARPTSTVNT-SPFPKSWDWRNII 117
Query  124  RLTRIRQQGSCGSCWAFAAAGVAESLYSIQK-QQSIELSEQELVDCTYNRYDSSYQCNGC 182
             +  I QQG C SCWAFAAA   E+ Y+ QK ++++ LS QELVDCT   +D  Y   GC
Sbjct  118  AFNSIEQQGRCSSCWAFAAATTVEAAYAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGC 177
Query  183  GSGYSTEAFKYMIRTGLVEEENYPYNMR-TQWCNPDV----EGQ--RYHVSGYQQLRYQS 235
              G+ TEA+KY++  G+ E++ Y Y     + C  D     +G+  +Y++S Y +L Y  
Sbjct  178  KGGWPTEAYKYIMDHGVYEDKLYHYTETFNEVCYADKVAHDKGHPVKYYISNYGRLAYND 237
Query  236  SDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGT-VQGV 294
            +DE +M  +  +GP  + +HG+++ FR    G++R V  N AYT+H V++VG+GT   GV
Sbjct  238  TDEAIMAMLVTYGPGTVDIHGTSDTFRFYKGGIMRNVMPNSAYTNHIVVVVGYGTDSSGV 297
Query  295  DYWIIRNSWGTGWGNGGYGYVERGHNSLGINNFVTYATL 333
            DYWIIRNSWG  WG  GYG +ER  N LG NN   Y  L
Sbjct  298  DYWIIRNSWGKTWGEHGYGRLERHPNLLGFNNKYNYPIL 336

Sequence Alignment: 4. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 176.6 bits 635,  Expect = 1e-45
 Identities = 113/314 35%, Positives = 178/314 56%, Gaps = 22/314 7%
Query  4    LLVAALCALVAIGSCKPTREEIKT-FEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEH 62
            LL+ +L A+ A    + T +E+K  +E +   +GK Y +  E  RR   FKE L++++EH
Sbjct  18   LLILSL-AFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEH 76
Query  63   NGIDGVEYAI--NEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGS-LPQNFDW 119
            N      Y +  N+++D++++EF     G        K+    EP    +G  LP   DW
Sbjct  77   NADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNRYEP---RFGQVLPSYVDW 133
Query  120  RQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQC 179
            R    +  I+ QG CG CWAF+A    E +  I     I LSEQEL+DC   R  ++  C
Sbjct  134  RSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDC--GRTQNTRGC 191
Query  180  NGCGSGYSTEAFKYMIRTGLVE-EENYPYNMRTQWCNPDVEGQRY-HVSGYQQLRYQSSD 237
            NG   GY T+ F+++I  G +  EENYPY  +   CN D++ ++Y  +  Y+ + Y  ++
Sbjct  192  NG---GYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENVPY--NN 246
Query  238  EDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYW 297
            E  + T   + PV + +  + + F++  +G++ G        DHAV +VG+GT  G+DYW
Sbjct  247  EWALQTAVTYQPVSVALDAAGDAFKHYSSGIFTGPC--GTAIDHAVTIVGYGTEGGIDYW 304
Query  298  IIRNSWGTGWGNGGYGYVER---GHNSLGINNFVTY 330
            I++NSW T WG  GY  + R   G  + GI    +Y
Sbjct  305  IVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY 340

Sequence Alignment: 5. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 175.5 bits 631,  Expect = 3e-45
 Identities = 111/315 35%, Positives = 176/315 55%, Gaps = 20/315 6%
Query  4    LLVAALCALVAIGSCKPTREEIKT-FEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEH 62
            LL+ +L A+ A    + T +E+K  +E +   +GK Y +  E  RR   FKE L++++EH
Sbjct  18   LLILSL-AFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEH 76
Query  63   NGIDGVEYAI--NEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWR 120
            N      Y +  N+++D++++EF     G        K+    EP +     LP   DWR
Sbjct  77   NADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNRYEPRVGQV--LPSYVDWR 134
Query  121  QKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCN 180
                +  I+ QG CG CWAF+A    E +  I     I LSEQEL+DC   R  ++  CN
Sbjct  135  SAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDC--GRTQNTRGCN 192
Query  181  GCGSGYSTEAFKYMIRTGLVE-EENYPYNMRTQWCNPDVEGQRY-HVSGYQQLRYQSSDE 238
            G   GY T+ F+++I  G +  EENYPY  +   CN +++ ++Y  +  Y+ + Y  ++E
Sbjct  193  G---GYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY--NNE 247
Query  239  DVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWI 298
              + T   + PV + +  + + F+   +G++ G        DHAV +VG+GT  G+DYWI
Sbjct  248  WALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPC--GTAIDHAVTIVGYGTEGGIDYWI 305
Query  299  IRNSWGTGWGNGGYGYVER---GHNSLGINNFVTY 330
            ++NSW T WG  GY  + R   G  + GI    +Y
Sbjct  306  VKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY 340

Sequence Alignment: 6. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 157.4 bits 563,  Expect = 7e-40
 Identities = 115/293 39%, Positives = 168/293 57%, Gaps = 29/293 9%
Query  1    MKFLL-VAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWV 59
            MK +L +A+L AL A+ + +P+   IKTFE++KK F K Y   E+E     +F E +K+V
Sbjct  1    MKIVLAIASLLALSAVYA-RPSS--IKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYV 57
Query  60   EEHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME---AAKEPLINTYGSLPQN 116
            + + G      AIN  SD+S  EF   +      F ++K +    A+    +  G+ P  
Sbjct  58   QSNGG------AINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAE 111
Query  117  FDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSS 176
             D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC        
Sbjct  112  IDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ----- 166
Query  177  YQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQS 235
               +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y Q+   +
Sbjct  167  ---HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYCQIYPPN 221
Query  236  SDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILVGWGTVQ 292
             ++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +VG+   Q
Sbjct  222  VNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIVGYSNAQ 279
Query  293  GVDYWIIRNSWGTGWGNGGYGY 314
            GVDYWI+RNSW T WG+ GYGY
Sbjct  280  GVDYWIVRNSWDTNWGDNGYGY 301

Sequence Alignment: 7. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 153.1 bits 547,  Expect = 1e-38
 Identities = 108/272 39%, Positives = 155/272 56%, Gaps = 25/272 9%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IKTFE++KK F K Y   E+E     +F E +K+V+ + G      AIN  SD+S  EF 
Sbjct  5    IKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME---AAKEPLINTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFA 141
              +      F ++K +    A+    +  G+ P   D RQ   +T IR QG CGSCWAF+
Sbjct  59   NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFS 118
Query  142  AAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGLVE 201
                 ES Y   + QS++L+EQELVDC      S + CNG          +Y+   G+V+
Sbjct  119  GVAATESAYLAYRNQSLDLAEQELVDCA-----SQHGCNG---DTIPRGIEYIQHNGVVQ 170
Query  202  EENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN-N 259
            E  Y Y  R Q C  P+   QR+ +S Y Q+   ++++      Q H  + + +   + +
Sbjct  171  ESYYRYVAREQSCRRPNA--QRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLD 228
Query  260  YFRNL-GNGVL-RGVAYNDAYTDHAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
             FR+  G  ++ R   Y   Y  HAV +VG+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  229  AFRHYDGRTIIQRDNGYQPNY--HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGY 283

Sequence Alignment: 8. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 151.6 bits 542,  Expect = 5e-38
 Identities = 95/303 31%, Positives = 166/303 54%, Gaps = 27/303 8%
Query  21   TREEIKT-FEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYA----INEY 75
            T++++ + F+ +K   G+VY N EEEA+R   FK    ++ + N      ++    +N++
Sbjct  36   TQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKF 95
Query  76   SDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSL--PQNFDWRQKARLTRIRQQGS 133
            +D++ QEFS        + +     A K+     Y     P ++DWR+K  +T+++ QG 
Sbjct  96   ADITPQEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGG 155
Query  134  CGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKY 193
            CG  WAF+A G  E+ ++I     + LSEQELVDC         +  G  +G+  ++F++
Sbjct  156  CGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCV-------EESEGSYNGWQYQSFEW 208
Query  194  MIRTG-LVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQL-----RYQSSDEDVMYTIQQH 247
            ++  G +  +++YPY  +   C  +    +  + GY+ L       +S  E    +    
Sbjct  209  VLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILE 268
Query  248  GPVVIYMHGSNNYFRNLGNGVLRGVAYNDAY-TDHAVILVGWGTVQGVDYWIIRNSWGTG 306
             P+ + +   +  F     G+  G      Y  +H V+LVG+G+  GVDYWI +NSWG  
Sbjct  269  QPISVSIDAKD--FHLYTGGIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGED 326
Query  307  WGNGGYGYVERGHNSL----GINNFVTYAT 332
            WG  GY +++R   +L    G+N F +Y T
Sbjct  327  WGEDGYIWIQRNTGNLLGVCGMNYFASYPT 356

Sequence Alignment: 9. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 151.4 bits 541,  Expect = 6e-38
 Identities = 95/303 31%, Positives = 166/303 54%, Gaps = 27/303 8%
Query  21   TREEIKT-FEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYA----INEY 75
            T++++ + F+ +K   G+VY N EEEA+R   FK    ++ + N      ++    +N++
Sbjct  36   TQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKF 95
Query  76   SDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSL--PQNFDWRQKARLTRIRQQGS 133
            +D++ QEFS        + +     A K+     Y     P ++DWR+K  +T+++ QG 
Sbjct  96   ADITPQEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGG 155
Query  134  CGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKY 193
            CG  WAF+A G  E+ ++I     + LSEQELVDC         +  G  +G+  ++F++
Sbjct  156  CGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCV-------EESEGSYNGWQYQSFEW 208
Query  194  MIRTG-LVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQL-----RYQSSDEDVMYTIQQH 247
            ++  G +  +++YPY  +   C  +    +  + GY+ L       +S  E    +    
Sbjct  209  VLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILE 268
Query  248  GPVVIYMHGSNNYFRNLGNGVLRGVAYNDAY-TDHAVILVGWGTVQGVDYWIIRNSWGTG 306
             P+ + +   +  F     G+  G      Y  +H V+LVG+G+  GVDYWI +NSWG  
Sbjct  269  QPISVSIDAKD--FHLYTGGIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGFD 326
Query  307  WGNGGYGYVERGHNSL----GINNFVTYAT 332
            WG  GY +++R   +L    G+N F +Y T
Sbjct  327  WGEDGYIWIQRNTGNLLGVCGMNYFASYPT 356

Sequence Alignment: 10. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 150.2 bits 536,  Expect = 1e-37
 Identities = 105/272 38%, Positives = 152/272 55%, Gaps = 25/272 9%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IK FE++KK F K Y   E+E     +F E +K+V+ + G      AIN  SD+S  EF 
Sbjct  5    IKPFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME---AAKEPLINTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFA 141
              +      F ++K +    A+    +  G+ P   D RQ   +T IR QG CGSCWAF+
Sbjct  59   NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFS 118
Query  142  AAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGLVE 201
                 ES Y   + QS++L+EQELVDC           +GC         +Y+   G+V+
Sbjct  119  GVAATESAYLAYRNQSLDLAEQELVDCASQ--------HGCHGDTIPRGIEYIQHNGVVQ 170
Query  202  EENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN-N 259
            E  Y Y  R Q C  P+   QR+ +S Y Q+   ++++      Q H  + + +   + +
Sbjct  171  ESYYRYVAREQSCRRPNA--QRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLD 228
Query  260  YFRNL-GNGVL-RGVAYNDAYTDHAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
             FR+  G  ++ R   Y   Y  HAV +VG+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  229  AFRHYDGRTIIQRDNGYQPNY--HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGY 283

Sequence Alignment: 11. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 146.6 bits 523,  Expect = 1e-36
 Identities = 124/305 40%, Positives = 173/305 56%, Gaps = 32/305 10%
Query  1    MKFLL-VAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWV 59
            MK +L +A+L  L A+ + +P    IKTFE+FKK F K Y   E+E     +F E LK+V
Sbjct  1    MKIILAIASLLVLSAVYA-RPAS--IKTFEEFKKAFNKSYATPEKEEVARKNFLESLKYV 57
Query  60   EEHNGIDGVEYAINEYSDMSEQEFS--FHLSGGGLNFTYMKMEAAKEPL---INTYGSLP 114
            E + G      AIN  SD+S  EF   F ++   +     + +   E     IN+  SLP
Sbjct  58   ESNKG------AINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSV-SLP 110
Query  115  QNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYD 174
              +D R    +T IR QG CGSCWAF+     ES Y   +  S++L+EQELVDC      
Sbjct  111  SELDLRSLRTVTPIRNQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ--- 167
Query  175  SSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRY 233
                 NGC         +Y+ + G+V+E  YPY  R Q C+ P+   QRY +  Y Q+  
Sbjct  168  -----NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPN--AQRYGLKNYCQISP 220
Query  234  QSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVLR-GVAYNDAYTDHAVILVGWGT 290
              S++      Q H  V + +   + N FR+  G  +++    Y   Y  HAV +VG+G 
Sbjct  221  PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGYGN 278
Query  291  VQGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
             QGVDYWI+RNSW T WG+ GYGY     N + I  +
Sbjct  279  TQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQY 315

Sequence Alignment: 12. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 146.4 bits 522,  Expect = 2e-36
 Identities = 124/305 40%, Positives = 173/305 56%, Gaps = 32/305 10%
Query  1    MKFLL-VAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWV 59
            MK +L +A+L  L A+ + +P    IKTFE+FKK F K Y   E+E     +F E LK+V
Sbjct  1    MKIILAIASLLVLSAVYA-RPAS--IKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYV 57
Query  60   EEHNGIDGVEYAINEYSDMSEQEFS--FHLSGGGLNFTYMKMEAAKEPL---INTYGSLP 114
            E + G      AIN  SD+S  EF   F ++   +     + +   E     IN+  SLP
Sbjct  58   ESNKG------AINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSV-SLP 110
Query  115  QNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYD 174
              +D R    +T IR QG CGSCWAF+     ES Y   +  S++L+EQELVDC      
Sbjct  111  SELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ--- 167
Query  175  SSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRY 233
                 NGC         +Y+ + G+V+E  YPY  R Q C+ P+   QRY +  Y Q+  
Sbjct  168  -----NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPN--AQRYGLKNYCQISP 220
Query  234  QSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVLR-GVAYNDAYTDHAVILVGWGT 290
              S++      Q H  V + +   + N FR+  G  +++    Y   Y  HAV +VG+G 
Sbjct  221  PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGYGN 278
Query  291  VQGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
             QGVDYWI+RNSW T WG+ GYGY     N + I  +
Sbjct  279  TQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQY 315

Sequence Alignment: 13. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 146.4 bits 522,  Expect = 2e-36
 Identities = 124/305 40%, Positives = 173/305 56%, Gaps = 32/305 10%
Query  1    MKFLL-VAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWV 59
            MK +L +A+L  L A+ + +P    IKTFE+FKK F K Y   E+E     +F E LK+V
Sbjct  1    MKIILAIASLLVLSAVYA-RPAS--IKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYV 57
Query  60   EEHNGIDGVEYAINEYSDMSEQEFS--FHLSGGGLNFTYMKMEAAKEPL---INTYGSLP 114
            E + G      AIN  SD+S  EF   F ++   +     + +   E     IN+  SLP
Sbjct  58   ESNKG------AINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSV-SLP 110
Query  115  QNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYD 174
              +D R    +T IR QG CGSCWAF+     ES Y   +  S++L+EQELVDC      
Sbjct  111  SELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ--- 167
Query  175  SSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRY 233
                 NGC         +Y+ + G+V+E  YPY  R Q C+ P+   QRY +  Y Q+  
Sbjct  168  -----NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPN--AQRYGLKNYCQISP 220
Query  234  QSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVLR-GVAYNDAYTDHAVILVGWGT 290
              S++      Q H  V + +   + N FR+  G  +++    Y   Y  HAV +VG+G 
Sbjct  221  PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGYGN 278
Query  291  VQGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
             QGVDYWI+RNSW T WG+ GYGY     N + I  +
Sbjct  279  TQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQY 315

Sequence Alignment: 14. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 145.6 bits 519,  Expect = 2e-36
 Identities = 114/283 40%, Positives = 162/283 57%, Gaps = 30/283 10%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IKTFE+FKK F K Y   EEE     +F E LK+VE + G      AIN  SD+S  EF 
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWA 139
                     F  +K +    A+     IN+  ++P  +D R    +T IR QG CGSCWA
Sbjct  59   NRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  140  FAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGL 199
            F+     ES Y   +  S++LSEQELVDC           +GC         +Y+ + G+
Sbjct  118  FSGVAATESAYLAYRNTSLDLSEQELVDCASQ--------HGCHGDTIPRGIEYIQQNGV 169
Query  200  VEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN 258
            VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y    + +   + Q    +  + G  
Sbjct  170  VEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YPPDVKQIREALTQTHTAIAVIIGIK 226
Query  259  NY--FRNLGNGVLRGVAYNDAYTD--HAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            +   F++ G   +  + +++ Y    HAV +VG+G+ QGVDYWI+RNSW T WG+ GYGY
Sbjct  227  DLRAFQHYGGRTI--IQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGY 284
Query  315  VERGHNSLGINNF 327
             + G+N + I  +
Sbjct  285  FQAGNNLMMIEQY 297

Sequence Alignment: 15. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 144.5 bits 515,  Expect = 5e-36
 Identities = 116/283 40%, Positives = 161/283 56%, Gaps = 30/283 10%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IKTFE+FKK F K Y   EEE     +F E LK+VE + G      AIN  SD+S  EF 
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWA 139
                     F  +K +    A+     IN+  ++P  +D R    +T IR QG CGSCWA
Sbjct  59   NRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  140  FAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGL 199
            F+     ES Y   +  S++LSEQELVDC           +GC         +Y+ + G+
Sbjct  118  FSGVAATESAYLAYRNTSLDLSEQELVDCASQ--------HGCHGDTIPRGIEYIQQNGV 169
Query  200  VEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN 258
            VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y    + +   + Q    +  + G  
Sbjct  170  VEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YPPDVKQIREALTQTHTAIAVIIGIK 226
Query  259  NY--FRNL-GNGVL-RGVAYNDAYTDHAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            +   F++  G  ++ R   Y   Y  HAV +VG+G+ QGVDYWI+RNSW T WG+ GYGY
Sbjct  227  DLRAFQHYDGRTIIQRDNGYQPNY--HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGY 284
Query  315  VERGHNSLGINNF 327
             + G+N + I  +
Sbjct  285  FQAGNNLMMIEQY 297

Sequence Alignment: 16. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 144.5 bits 515,  Expect = 6e-36
 Identities = 122/305 40%, Positives = 173/305 56%, Gaps = 32/305 10%
Query  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
            MKF+L  A+ +L+ + +       IKTFE+FKK F K Y   EEE     +F E LK+VE
Sbjct  1    MKFVL--AIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVE 58
Query  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQ 115
             + G      AIN  SD+S  EF          F  +K +    A+     IN+  ++P 
Sbjct  59   ANKG------AINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPS 111
Query  116  NFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDS 175
             +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQELVDC       
Sbjct  112  ELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ---- 167
Query  176  SYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQ 234
                +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y 
Sbjct  168  ----HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YP 220
Query  235  SSDEDVMYTIQQHGPVVIYMHGSNNY--FRNL-GNGVLR-GVAYNDAYTDHAVILVGWGT 290
               + +   + Q    +  + G  +   F++  G  ++R    Y   Y  HAV +VG+G+
Sbjct  221  PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNY--HAVNIVGYGS 278
Query  291  VQGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
             QGVDYWI+RNSW T WG+ GYGY + G+N + I  +
Sbjct  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQY 315

Sequence Alignment: 17. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 143.7 bits 512,  Expect = 9e-36
 Identities = 115/284 40%, Positives = 161/284 56%, Gaps = 28/284 9%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IKTFE+FKK F K Y   EEE     +F E LK+VE + G      AIN  SD+S  EF 
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWA 139
                     F  +K +    A+     IN+  ++P  +D R    +T IR QG CGSCWA
Sbjct  59   NRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  140  FAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGL 199
            F+     ES Y   +  S++LSEQELVDC           +GC         +Y+ + G+
Sbjct  118  FSGVAATESAYLAYRNTSLDLSEQELVDCASQ--------HGCHGDTIPRGIEYIQQNGV 169
Query  200  VEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN 258
            VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y    + +   + Q    +  + G  
Sbjct  170  VEERSYPYVAREQQCRRPN--SQHYDISNYCQI-YPPDVKQIREALTQTHTAIAVIIGIK 226
Query  259  NYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYV 315
            + +R + +   R +  +D  Y    HAV +VG+G+ QGVDYWI+RNSW T WG+ GYGY 
Sbjct  227  D-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYF 285
Query  316  ERGHNSLGINNF 327
            + G+N + I  +
Sbjct  286  QAGNNLMMIEQY 297

Sequence Alignment: 18. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 143.4 bits 511,  Expect = 1e-35
 Identities = 121/306 39%, Positives = 173/306 56%, Gaps = 30/306 9%
Query  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
            MKF+L  A+ +L+ + +       IKTFE+FKK F K Y   EEE     +F E LK+VE
Sbjct  1    MKFVL--AIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVE 58
Query  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQ 115
             + G      AIN  SD+S  EF          F  +K +    A+     IN+  ++P 
Sbjct  59   ANKG------AINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPS 111
Query  116  NFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDS 175
             +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQELVDC       
Sbjct  112  ELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ---- 167
Query  176  SYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQ 234
                +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y 
Sbjct  168  ----HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YP 220
Query  235  SSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTV 291
               + +   + Q    +  + G  + +R + +   R +  +D  Y    HAV +VG+G+ 
Sbjct  221  PDVKQIREALTQTHTAIAVIIGIKD-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 279
Query  292  QGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
            QGVDYWI+RNSW T WG+ GYGY + G+N + I  +
Sbjct  280  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQY 315

Sequence Alignment: 19. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 142.9 bits 509,  Expect = 2e-35
 Identities = 115/284 40%, Positives = 161/284 56%, Gaps = 28/284 9%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IKTFE+FKK F K Y   EEE     +F E LK+VE + G      AIN  SD+S  EF 
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWA 139
                     F  +K +    A+     IN+  ++P  +D R    +T IR QG CGSCWA
Sbjct  59   NRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  140  FAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGL 199
            F+     ES Y   +  S++LSEQELVDC           +GC         +Y+ + G+
Sbjct  118  FSGVAATESAYLAYRNTSLDLSEQELVDCASQ--------HGCHGDTIPRGIEYIQQNGV 169
Query  200  VEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN 258
            VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y    + +   + Q    +  + G  
Sbjct  170  VEERSYPYVAREQRCRRPN--SQHYGISNYCQI-YPPDVKQIREALTQTHTAIAVIIGIK 226
Query  259  NYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYV 315
            + +R + +   R +  +D  Y    HAV +VG+G+ QGVDYWI+RNSW T WG+ GYGY 
Sbjct  227  D-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYF 285
Query  316  ERGHNSLGINNF 327
            + G+N + I  +
Sbjct  286  QAGNNLMMIEQY 297

Sequence Alignment: 20. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 142.6 bits 508,  Expect = 2e-35
 Identities = 121/306 39%, Positives = 172/306 56%, Gaps = 30/306 9%
Query  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
            MKF+L  A+ +L+ + +       IKTFE+FKK F K Y   EEE     +F E LK+VE
Sbjct  1    MKFVL--AIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVE 58
Query  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQ 115
             + G      AIN  SD+S  EF          F  +K +    A+     IN+  ++P 
Sbjct  59   ANKG------AINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPS 111
Query  116  NFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDS 175
             +D R     T IR QG CGSCWAF+     ES Y   +  S++LSEQELVDC       
Sbjct  112  ELDLRSLRTATPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ---- 167
Query  176  SYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQ 234
                +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y 
Sbjct  168  ----HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YP 220
Query  235  SSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTV 291
               + +   + Q    +  + G  + +R + +   R +  +D  Y    HAV +VG+G+ 
Sbjct  221  PDVKQIREALTQTHTAIAVIIGIKD-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 279
Query  292  QGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
            QGVDYWI+RNSW T WG+ GYGY + G+N + I  +
Sbjct  280  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQY 315

Sequence Alignment: 21. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 142.1 bits 506,  Expect = 3e-35
 Identities = 120/306 39%, Positives = 173/306 56%, Gaps = 30/306 9%
Query  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
            MKF+L  A+ +L+ + +       IKTFE+FKK F K Y   EEE     +F E LK+VE
Sbjct  1    MKFVL--AIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVE 58
Query  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQ 115
             + G      AIN  SD+S  EF          F  +K +    A+     IN+  ++P 
Sbjct  59   ANKG------AINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPS 111
Query  116  NFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDS 175
             +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQ+LVDC       
Sbjct  112  ELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQ---- 167
Query  176  SYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQ 234
                +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y 
Sbjct  168  ----HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YP 220
Query  235  SSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTV 291
               + +   + Q    +  + G  + +R + +   R +  +D  Y    HAV +VG+G+ 
Sbjct  221  PDVKQIREALTQTHTAIAVIIGIKD-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 279
Query  292  QGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
            QGVDYWI+RNSW T WG+ GYGY + G+N + I  +
Sbjct  280  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQY 315

Sequence Alignment: 22. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 140.5 bits 500,  Expect = 9e-35
 Identities = 120/306 39%, Positives = 172/306 56%, Gaps = 30/306 9%
Query  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
            MKF+L  A+ +L+ + +       IKTFE+FKK F K Y   EEE     +F E LK+VE
Sbjct  1    MKFVL--AIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVE 58
Query  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME---AAKEPL--INTYGSLPQ 115
             + G      AIN  SD+S  EF          F  +K +    A+     IN+  ++P 
Sbjct  59   ANKG------AINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPS 111
Query  116  NFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDS 175
             +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQELVDC       
Sbjct  112  ELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ---- 167
Query  176  SYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQ 234
                +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y 
Sbjct  168  ----HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCRRPN--SQHYGISNYCQI-YP 220
Query  235  SSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTV 291
               + +   + Q    +  + G  + +R + +   R +  +D  Y    HAV +VG+G+ 
Sbjct  221  PDVKQIREALTQTHTAIAVIIGIKD-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 279
Query  292  QGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327
            QG DYWI+RNSW T WG+ GYGY + G+N + I  +
Sbjct  280  QGDDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQY 315

Sequence Alignment: 23. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 138.6 bits 493,  Expect = 3e-34
 Identities = 113/284 39%, Positives = 158/284 55%, Gaps = 28/284 9%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
            IKTFE+FKK F K Y   EEE     +F E LK+VE + G      AIN  SD+S  EF 
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKG------AINHLSDLSLDEFK 58
Query  85   FHLSGGGLNFTYMKME-----AAKEPLINTYGSLPQNFDWRQKARLTRIRQQGSCGSCWA 139
                     F  +K +           IN+  ++P  +D R    +T IR QG CGSCWA
Sbjct  59   NRYLMSAEAFEQLKTQFDLNAEISACRINSV-NVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  140  FAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGL 199
            F+     ES Y   +  S++LSEQELVDC           +G          +Y+ + G+
Sbjct  118  FSGVAATESAYLAYRNTSLDLSEQELVDCASQ--------HGRHGDTIPRGIEYIQQNGV 169
Query  200  VEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN 258
            VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y    + +   + Q    +  + G  
Sbjct  170  VEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YPPDVKQIREALTQTHTAIAVIIGIK 226
Query  259  NYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYV 315
            + +R + +   R +  +D  Y    HAV +VG+G+ QGVDYWI+RNSW T WG+ GYGY 
Sbjct  227  D-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYF 285
Query  316  ERGHNSLGINNF 327
            + G+N + I  +
Sbjct  286  QAGNNLMMIEQY 297

Sequence Alignment: 24. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 137.8 bits 489,  Expect = 4e-34
 Identities = 84/195 43%, Positives = 114/195 58%, Gaps = 17/195 8%
Query  107  INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELV 166
            IN+  SLP  +D R    +T IR QG CGSCWAF+     ES Y   +  S++L+EQELV
Sbjct  6    INSV-SLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELV 64
Query  167  DCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHV 225
            DC           NGC         +Y+ + G+V+E  YPY  R Q C+ P+   QRY +
Sbjct  65   DCASQ--------NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPN--AQRYGL 114
Query  226  SGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVLR-GVAYNDAYTDHA 282
              Y Q+    S++      Q H  V + +   + N FR+  G  +++    Y   Y  HA
Sbjct  115  KNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HA 172
Query  283  VILVGWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            V +VG+G  QGVDYWI+RNSW T WG+ GYGY
Sbjct  173  VNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGY 204

Sequence Alignment: 25. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 136.2 bits 483,  Expect = 1e-33
 Identities = 82/201 40%, Positives = 118/201 58%, Gaps = 17/201 8%
Query  107  INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELV 166
            IN+  ++P  +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQELV
Sbjct  7    INSV-NVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELV 65
Query  167  DCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHV 225
            DC           +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +
Sbjct  66   DCASQ--------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGI 115
Query  226  SGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYND-AYTD--HA 282
            S Y Q+ Y    + +   + Q    +  + G  + +R + +   R +  +D  Y    HA
Sbjct  116  SNYCQI-YPPDVKQIREALTQTHTAIAVIIGIKD-LRAFQHYDGRTIIQHDNGYQPNYHA 173
Query  283  VILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYVERGHN 320
            V +VG+G+ QGVDYWI+RNSW T WG+ GYGY + G+N
Sbjct  174  VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNN 211

Sequence Alignment: 26. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 131.0 bits 465,  Expect = 7e-32
 Identities = 103/295 34%, Positives = 173/295 58%, Gaps = 30/295 10%
Query  9    LCALVAIGSC----KPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNG 64
            LCA+ A  S     +P    +K FE++   +G+VY++ +E+ RR + FK  +K +E  N 
Sbjct  14   LCAMWASPSAASRDEPNDPMMKRFEEWMAEYGRVYKDDDEKMRRFQIFKNNVKHIETFNS 73
Query  65   IDGVEYA--INEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLIN----TYGSLPQNFD 118
             +   Y   IN+++DM++ EF  + +G       + +   +EP+++       ++PQ+ D
Sbjct  74   RNENSYTLGINQFTDMTKSEFVAQYTG-----VSLPLNIEREPVVSFDDVNISAVPQSID 128
Query  119  WRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQ 178
            WR    +  ++ Q  CGSCW+FAA    E +Y I+    + LSEQE++DC       SY 
Sbjct  129  WRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAV-----SY- 182
Query  179  CNGCGSGYSTEAFKYMIRT-GLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLRYQSSD 237
              GC  G+  +A+ ++I   G+  EENYPY      CN +      +++GY  +R ++ +
Sbjct  183  --GCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAYITGYSYVR-RNDE 239
Query  238  EDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGT-VQGVDY 296
              +MY +  + P+   +  S N F+    GV+ G        +HA+ ++G+G    G  Y
Sbjct  240  RSMMYAVSNQ-PIAALIDASEN-FQYYNGGVFSGPCGTS--LNHAITIIGYGQDSSGTKY 295
Query  297  WIIRNSWGTGWGNGGYGYVERGHNS 321
            WI+RNSWG+ WG GGY  + RG +S
Sbjct  296  WIVRNSWGSSWGEGGYVRMARGVSS 320

Sequence Alignment: 27. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 124.0 bits 439,  Expect = 9e-30
 Identities = 106/292 36%, Positives = 166/292 56%, Gaps = 22/292 7%
Query  21   TREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEY-AINEYSDMS 79
            T   I+ FE +     K+Y+N +E+  R   FK+ LK+++E N  +   +  +N ++DMS
Sbjct  41   TERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMS 100
Query  80   EQEFSFHLSGGGLNFTYMKMEAAKEPLINTYG-SLPQNFDWRQKARLTRIRQQGSCGSCW 138
              EF    +G  +   Y   E + E ++N    ++P+  DWRQK  +T ++ QGSCGSCW
Sbjct  101  NDEFKEKYTGS-IAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCW 159
Query  139  AFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTG 198
            AF+A    E +  I+     E SEQEL+DC  +R   SY CNG   GY   A++ + + G
Sbjct  160  AFSAVVTIEGIIKIRTGNLNEYSEQELLDC--DR--RSYGCNG---GYPWSALQLVAQYG 212
Query  199  LVEEENYPYNMRTQWCNPDVEGQRY-HVSGYQQLRYQSSDED-VMYTIQQHGPVVIYMHG 256
            +     YPY    ++C    +G       G +Q+  Q  +E  ++Y+I  + PV + +  
Sbjct  213  IHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQV--QPYNEGALLYSIANQ-PVSVVLEA 269
Query  257  SNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYVE 316
            +   F+    G++ G   N    DHAV  VG+G     +Y +I+NSWGTGWG  GY  ++
Sbjct  270  AGKDFQLYRGGIFVGPCGNKV--DHAVAAVGYGP----NYILIKNSWGTGWGENGYIRIK 323
Query  317  RGH-NSLGINNFVT 329
            RG  NS G+  + T
Sbjct  324  RGTGNSYGVCGLYT 337

Sequence Alignment: 28. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 120.3 bits 424,  Expect = 7e-29
 Identities = 78/192 40%, Positives = 109/192 56%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+  S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGTSNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 29. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 119.7 bits 422,  Expect = 1e-28
 Identities = 78/192 40%, Positives = 110/192 57%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVLR-GVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++R    Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 30. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 119.7 bits 422,  Expect = 1e-28
 Identities = 78/192 40%, Positives = 110/192 57%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 31. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 119.7 bits 422,  Expect = 1e-28
 Identities = 78/192 40%, Positives = 110/192 57%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 32. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 119.7 bits 422,  Expect = 1e-28
 Identities = 78/192 40%, Positives = 110/192 57%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNT--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 33. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 119.5 bits 421,  Expect = 1e-28
 Identities = 78/192 40%, Positives = 110/192 57%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 34. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 119.2 bits 420,  Expect = 2e-28
 Identities = 78/192 40%, Positives = 109/192 56%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC          Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 35. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 119.2 bits 420,  Expect = 2e-28
 Identities = 78/192 40%, Positives = 109/192 56%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   + ++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 36. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 118.4 bits 417,  Expect = 3e-28
 Identities = 78/192 40%, Positives = 108/192 56%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC          Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   + ++      Q H  + + +   + + FR+  G  ++ R   Y   Y  HAV +V
Sbjct  118  QIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 37. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 117.3 bits 413,  Expect = 6e-28
 Identities = 77/192 40%, Positives = 110/192 57%, Gaps = 16/192 8%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y   + QS++L+EQELVDC  
Sbjct  8    GNAPAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCAS 67
Query  171  NRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQ 229
                     +GC         +Y+   G+V+E  Y Y  R Q C  P+   QR+ +S Y 
Sbjct  68   Q--------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNA--QRFGISNYC 117
Query  230  QLRYQSSDEDVMYTIQQHGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILV 286
            Q+   ++++      Q H  + + +   + + FR+  G  ++ R   Y   Y  +AV +V
Sbjct  118  QIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--YAVNIV 175
Query  287  GWGTVQGVDYWIIRNSWGTGWGNGGYGY 314
            G+   QGVDYWI+RNSW T WG+ GYGY
Sbjct  176  GYSNAQGVDYWIVRNSWDTNWGDNGYGY 203

Sequence Alignment: 38. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 114.3 bits 403,  Expect = 7e-27
 Identities = 94/288 32%, Positives = 151/288 52%, Gaps = 15/288 5%
Query  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEY-AINEYSDMSEQEF 83
            I+ F+ +     K+Y + +E+  R   F++ L +++E N  +   +  +N ++D+S  EF
Sbjct  45   IQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLSNDEF 104
Query  84   SFHLSGG-GLNFTYMKMEAAKEPLINTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFAA 142
                 G    +FT ++    ++       + PQ+ DWR K  +T ++ QG+CGSCWAF+ 
Sbjct  105  KKKYVGFVAEDFTGLEHFDNEDFTYKHVTNYPQSIDWRAKGAVTPVKNQGACGSCWAFST 164
Query  143  AGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEE 202
                E +  I     +ELSEQELVDC  + Y       GC  GY T +++Y+   G+   
Sbjct  165  IATVEGINKIVTGNLLELSEQELVDCDKHSY-------GCKGGYQTTSLQYVANNGVHTS 217
Query  203  ENYPYNMRTQWCNP-DVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSNNYF 261
            + YPY  +   C   D  G +  ++GY+  R  S+ E        + P+ + +      F
Sbjct  218  KVYPYQAKQYKCRATDKPGPKVKITGYK--RVPSNCETSFLGALANQPLSVLVEAGGKPF 275
Query  262  RNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYVER-GHN 320
            +   +GV+ G        DHAV  VG+GT  G +Y II+NSWG  WG  GY  ++R   N
Sbjct  276  QLYKSGVFDGPC--GTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGN 333
Query  321  SLG 323
            S G
Sbjct  334  SQG 336

Sequence Alignment: 39. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 96.0 bits 335,  Expect = 3e-21
 Identities = 88/299 29%, Positives = 157/299 52%, Gaps = 26/299 8%
Query  24   EIKTFEQFKKVFGKVYRNAEEEAR---REHHFKEQLKWVEEHNGIDG-VEYAINEYSDMS 79
            E+++ E F  ++ +       E R   R + FK  ++ + E N +D   +  +NE++DM+
Sbjct  29   ELESEEGFMGMYDRWREQHNIEMRSPERFNVFKYNVRRIHESNKMDKPYKLKVNEFADMT 88
Query  80   EQEFSFHLSGGGLN-FTYMKMEAA--------KEPLINTYGSLPQNFDWRQKARLTRIRQ 130
              EF    +   ++ F  ++  A         K+ +      +P   DWR+K  +T ++ 
Sbjct  89   NLEFVNTYANSKISHFQALRGSAPGSIDTDPNKDFIYANVTKIPDKVDWREKNAVTDVKG 148
Query  131  QGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEA 190
            QG CGSCWAFAA    E + +I+  + +++SEQ+LVDC            GC  G    A
Sbjct  149  QGGCGSCWAFAAVVALEGINAIRTGKLVKFSEQQLVDCDMTN-------AGCDGGLMEPA 201
Query  191  FKYMIRTG-LVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGP 249
            F Y+I+ G +  E +YPY  + + C+         + G Q +     DE+ +     H P
Sbjct  202  FTYVIKHGGIAPEASYPYVGKRETCDKAKIKDVLKIDGRQNV--PGLDEEALRKAVAHQP 259
Query  250  VVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWG-TVQGVDYWIIRNSWGTGWG 308
            V   ++ S + ++    GV  G    +   +H V +VG+G   +G+ +W ++NSWG  WG
Sbjct  260  VATGIQLSGHGLQFYSEGVYTGDCGTEP--NHGVGIVGYGENEKGIKFWTVKNSWGPTWG 317
Query  309  NGGYGYVERGHNSLGINNFVTYATL 333
              GY +++RG    G+     ++++
Sbjct  318  EKGYIHLQRGARKEGLCGVAMHSSF 342

Sequence Alignment: 40. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 67.4 bits 225,  Expect = 3e-13
 Identities = 33/66 50%, Positives = 43/66 65%, Gaps = 5/66 7%
Query  111  GSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTY 170
            G+ P   D RQ   +T IR QG CGSCWAF+     ES Y  ++ QS++L+EQELVDC  
Sbjct  26   GNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLAEQELVDCA- 84
Query  171  NRYDSSYQCNG 181
                S + C+G
Sbjct  85   ----SQHGCHG 91

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.