The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN
KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT
VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE
YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI
IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY
GYFQAGNNLMMIEQYPYVVIM
Sequence Info Allergen Name Length Opt Bits Score E Value
ABL84751 Der f 1.0110 321 2145 482.7 8.5e-138
BAC53948 Der f 1.0101 321 2139 481.3 2.1e-137
ABL84750 Der f 1.0109 321 2134 480.2 4.6e-137
ABL84749 Der f 1.0108 321 2134 480.2 4.6e-137
P16311 Der f 1 321 2124 478.0 2.1e-136
2428875 Der f 1.0107 303 2034 458.1 1.9e-130
2428875 Der f 1.0105 303 2031 457.5 3.1e-130
2428875 Der f 1.0103 303 2031 457.5 3.1e-130
2428875 Der f 1.0102 303 2030 457.2 3.6e-130
2428875 Der f 1.0104 303 2017 454.4 2.6e-129
P25780 Eur m 1.0101 321 1888 425.7 1.2e-120
AAC82351 Eur m 1.0101 321 1888 425.7 1.2e-120
AAC82352 Eur m 1.0102 321 1883 424.6 2.5e-120
P08176 Der p 1 320 1820 410.7 4e-116
ABA39435 Der p 1.0113 302 1728 390.3 5e-110
CAQ68250 Der p 1.0124 302 1725 389.7 7.9e-110
CAA46316 Der f 1 212 1467 332.9 6.8e-93
6771329 Der p 1.0120 222 1300 295.9 1e-81
6771329 Der p 1.0117 222 1299 295.6 1.2e-81
6771329 Der p 1.0115 222 1295 294.7 2.2e-81
6771329 Der p 1.0118 222 1293 294.3 3e-81
6771329 Der p 1.0119 222 1290 293.6 4.7e-81
6771329 Der p 1.0123 222 1290 293.6 4.7e-81
6771329 Der p 1.0121 222 1289 293.4 5.5e-81
6771329 Der p 1.0116 222 1288 293.2 6.4e-81
6771329 Der p 1.0122 222 1288 293.2 6.4e-81
6771329 Der p 1.0114 222 1287 293.0 7.4e-81
CAA42677 Eur m 1.0101 211 1275 290.4 4.3e-80
AAA28296 Der p 1 96 575 136.2 5.2e-34
P14080 Cari p 2.0101 352 523 123.2 1.5e-29
AAK58415 Blo t 1.0101 221 515 121.9 2.3e-29
AAQ24541 Blo t 1.0201 333 515 121.5 4.7e-29
P00785 Act d 1 380 508 119.8 1.8e-28
AAA32629 Act d 1 380 504 118.9 3.2e-28
BAA21849 Ana c 2 351 491 116.1 2.1e-27
V5LU01 Amb a 11.0101 386 479 113.3 1.6e-26
AAB02650 Car p papain 345 439 104.6 5.9e-24
AAB09252 Gly m 1 379 425 101.4 6e-23
P22895 Gly m 1 379 424 101.2 7e-23
ABM53753 Tyr p 1.0101 336 269 67.0 1.2e-12
P16312 Der m 1 30 177 49.3 2.3e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 482.7 bits 2145,  Expect = 9e-138
 Identities = 321/321 100%, Positives = 321/321 100%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN
Sbjct  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE
Sbjct  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI
Sbjct  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY
Sbjct  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYFQAGNNLMMIEQYPYVVIM
Sbjct  301  GYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 2. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 481.3 bits 2139,  Expect = 2e-137
 Identities = 320/321 99%, Positives = 321/321 100%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN
Sbjct  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE
Sbjct  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI
Sbjct  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDLRAFQHYDGRTII+HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY
Sbjct  241  IGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYFQAGNNLMMIEQYPYVVIM
Sbjct  301  GYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 3. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 480.2 bits 2134,  Expect = 5e-137
 Identities = 319/321 99%, Positives = 321/321 100%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN
Sbjct  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ+LVDCASQHGCHGDTIPRGIE
Sbjct  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI
Sbjct  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDLRAFQHYDGRTII+HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY
Sbjct  241  IGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYFQAGNNLMMIEQYPYVVIM
Sbjct  301  GYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 4. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 480.2 bits 2134,  Expect = 5e-137
 Identities = 319/321 99%, Positives = 320/321 99%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN
Sbjct  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
             TPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE
Sbjct  121  ATPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI
Sbjct  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDLRAFQHYDGRTII+HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY
Sbjct  241  IGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYFQAGNNLMMIEQYPYVVIM
Sbjct  301  GYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 5. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 478.0 bits 2124,  Expect = 2e-136
 Identities = 318/321 99%, Positives = 320/321 99%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN
Sbjct  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE
Sbjct  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVVEERSYPYVAREQ+CRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI
Sbjct  181  YIQQNGVVEERSYPYVAREQRCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDLRAFQHYDGRTII+HDNGYQPNYHAVNIVGYGSTQG DYWIVRNSWDTTWGDSGY
Sbjct  241  IGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGDDYWIVRNSWDTTWGDSGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYFQAGNNLMMIEQYPYVVIM
Sbjct  301  GYFQAGNNLMMIEQYPYVVIM 321

Sequence Alignment: 6. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 458.1 bits 2034,  Expect = 2e-130
 Identities = 301/303 99%, Positives = 303/303 100%, Gaps = 0/303 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQ+CRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQRCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            +HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  319  VIM 321
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 7. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 457.5 bits 2031,  Expect = 3e-130
 Identities = 301/303 99%, Positives = 302/303 99%, Gaps = 0/303 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQQCRRPNSQHY ISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQQCRRPNSQHYDISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            +HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  319  VIM 321
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 8. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 457.5 bits 2031,  Expect = 3e-130
 Identities = 301/303 99%, Positives = 302/303 99%, Gaps = 0/303 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHY GRTII
Sbjct  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGGRTII 240
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            +HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  319  VIM 321
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 9. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 457.2 bits 2030,  Expect = 4e-130
 Identities = 301/303 99%, Positives = 302/303 99%, Gaps = 0/303 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            + DNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QRDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  319  VIM 321
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 10. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 454.4 bits 2017,  Expect = 3e-129
 Identities = 300/303 99%, Positives = 301/303 99%, Gaps = 0/303 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            +HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  319  VIM 321
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 11. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 425.7 bits 1888,  Expect = 1e-120
 Identities = 276/321 85%, Positives = 300/321 93%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MK +LAIASLLVLS VYARPASIKTFEEFKKAFNK YAT E+EEVARKNFLESLKYVE+N
Sbjct  1    MKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYVESN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKN++LM+A AFEQLKTQFDLNAET AC INSV++PSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+EQELVDCASQ+GCHGDTIPRGIE
Sbjct  121  VTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQI PPD  +IR+ALTQTHTA+AVI
Sbjct  181  YIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDL AF+HYDGRTI++HDNGYQPNYHAVNIVGYG+TQGVDYWIVRNSWDTTWGD+GY
Sbjct  241  IGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYF A  NLMMIEQYPYVV++
Sbjct  301  GYFAANINLMMIEQYPYVVML 321

Sequence Alignment: 12. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 425.7 bits 1888,  Expect = 1e-120
 Identities = 276/321 85%, Positives = 300/321 93%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MK +LAIASLLVLS VYARPASIKTFEEFKKAFNK YAT E+EEVARKNFLESLKYVE+N
Sbjct  1    MKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYVESN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKN++LM+A AFEQLKTQFDLNAET AC INSV++PSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+EQELVDCASQ+GCHGDTIPRGIE
Sbjct  121  VTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQI PPD  +IR+ALTQTHTA+AVI
Sbjct  181  YIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDL AF+HYDGRTI++HDNGYQPNYHAVNIVGYG+TQGVDYWIVRNSWDTTWGD+GY
Sbjct  241  IGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYF A  NLMMIEQYPYVV++
Sbjct  301  GYFAANINLMMIEQYPYVVML 321

Sequence Alignment: 13. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 424.6 bits 1883,  Expect = 3e-120
 Identities = 276/321 85%, Positives = 300/321 93%, Gaps = 0/321 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MK +LAIASLLVLS VYARPASIKTFEEFKKAFNK+YAT E+EEVARKNFLESLKYVE+N
Sbjct  1    MKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKSYATPEKEEVARKNFLESLKYVESN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
            KGAINHLSDLSLDEFKN++LM+A AFEQLKTQFDLNAET AC INSV++PSELDLRSLRT
Sbjct  61   KGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRT 120
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIR QGGCGSCWAFSGVA+TESAYLAYRN SLDL+EQELVDCASQ+GCHGDTIPRGIE
Sbjct  121  VTPIRNQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDTIPRGIE 180
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQI PPD  +IR+ALTQTHTA+AVI
Sbjct  181  YIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVI 240
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDL AF+HYDGRTI++HDNGYQPNYHAVNIVGYG+TQGVDYWIVRNSWDTTWGD+GY
Sbjct  241  IGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY 300
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYF A  NLMMIEQYPYVVI+
Sbjct  301  GYFAANINLMMIEQYPYVVIL 321

Sequence Alignment: 14. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 410.7 bits 1820,  Expect = 4e-116
 Identities = 266/320 83%, Positives = 294/320 91%, Gaps = 1/320 0%
Query  1    MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN 60
            MK VLAIASLL LS VYARP+SIKTFEE+KKAFNK+YAT E+EE ARKNFLES+KYV++N
Sbjct  1    MKIVLAIASLLALSAVYARPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSN 60
Query  61   KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT 120
             GAINHLSDLSLDEFKNR+LMSAEAFE+LKTQFDLNAET+AC IN  N P+E+DLR +RT
Sbjct  61   GGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRT 119
Query  121  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIE 180
            VTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQELVDCASQHGCHGDTIPRGIE
Sbjct  120  VTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIE 179
Query  181  YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVI 240
            YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIYPP+V +IREAL QTH+AIAVI
Sbjct  180  YIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVI 239
Query  241  IGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 300
            IGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY + QGVDYWIVRNSWDT WGD+GY
Sbjct  240  IGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY 299
Query  301  GYFQAGNNLMMIEQYPYVVIM 321
            GYF A  +LMMIE+YPYVVI+
Sbjct  300  GYFAANIDLMMIEEYPYVVIL 320

Sequence Alignment: 15. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 390.3 bits 1728,  Expect = 5e-110
 Identities = 249/302 82%, Positives = 277/302 91%, Gaps = 1/302 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RP+SIK FEE+KKAFNK+YAT E+EE ARKNFLES+KYV++N GAINHLSDLSLDEFKNR
Sbjct  1    RPSSIKPFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            +LMSAEAFE+LKTQFDLNAET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSG
Sbjct  61   FLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSG 119
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRN SLDL+EQELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAR
Sbjct  120  VAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAR 179
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQ CRRPN+Q +GISNYCQIYPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII
Sbjct  180  EQSCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII 239
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            + DNGYQPNYHAVNIVGY + QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYV
Sbjct  240  QRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV 299
Query  319  VIM 321
            VI+
Sbjct  300  VIL 302

Sequence Alignment: 16. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 389.7 bits 1725,  Expect = 8e-110
 Identities = 249/302 82%, Positives = 278/302 92%, Gaps = 1/302 0%
Query  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
            RP+SIKTFEE+KKAFNK+YAT E+EE ARKNFLES+KYV++N GAINHLSDLSLDEFKNR
Sbjct  1    RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNR 60
Query  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
            +LMSAEAFE+LKTQFDLNAET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSG
Sbjct  61   FLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSG 119
Query  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
            VAATESAYLAYRN SLDL+EQELVDCASQHGC+GDTIPRGIEYIQ+NGVV+E  Y YVAR
Sbjct  120  VAATESAYLAYRNQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAR 179
Query  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
            EQ CRRPN+Q +GISNYCQIYPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII
Sbjct  180  EQSCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII 239
Query  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
            + DNGYQPNYHAVNIVGY + QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYV
Sbjct  240  QRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV 299
Query  319  VIM 321
            VI+
Sbjct  300  VIL 302

Sequence Alignment: 17. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 332.9 bits 1467,  Expect = 7e-93
 Identities = 211/212 99%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  98   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 157
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
Query  158  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 217
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
Query  218  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYG 277
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII+HDNGYQPNYHAVNIVGYG
Sbjct  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
Query  278  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 309
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212

Sequence Alignment: 18. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 295.9 bits 1300,  Expect = 1e-81
 Identities = 183/222 82%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIR DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 19. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 295.6 bits 1299,  Expect = 1e-81
 Identities = 183/222 82%, Positives = 202/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREALTQTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 20. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 294.7 bits 1295,  Expect = 2e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNTQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 21. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 294.3 bits 1293,  Expect = 3e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 22. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 293.6 bits 1290,  Expect = 5e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGI YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 23. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 293.6 bits 1290,  Expect = 5e-81
 Identities = 182/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222

Sequence Alignment: 24. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 293.4 bits 1289,  Expect = 5e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222

Sequence Alignment: 25. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 293.2 bits 1288,  Expect = 6e-81
 Identities = 182/222 81%, Positives = 201/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR LRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNY+AVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYYAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 26. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 293.2 bits 1288,  Expect = 6e-81
 Identities = 181/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +G SNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGTSNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 27. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 293.0 bits 1287,  Expect = 7e-81
 Identities = 181/222 81%, Positives = 200/222 90%, Gaps = 1/222 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQHGCHGDTIPRGI YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 321
             QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 28. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 290.4 bits 1275,  Expect = 4e-80
 Identities = 179/211 84%, Positives = 195/211 92%, Gaps = 0/211 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 158
            T AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+E
Sbjct  1    TYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAE 60
Query  159  QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 218
            QELVDCASQ+GCHGDTIPRGIEYIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQI
Sbjct  61   QELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI 120
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGS 278
             PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI++HDNGYQPNYHAVNIVGYG+
Sbjct  121  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGN 180
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 309
            TQGVDYWIVRNSWDTTWGD+GYGYF A  NL
Sbjct  181  TQGVDYWIVRNSWDTTWGDNGYGYFAANINL 211

Sequence Alignment: 29. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 136.2 bits 575,  Expect = 5e-34
 Identities = 84/96 87%, Positives = 91/96 94%, Gaps = 1/96 1%
Query  81   MSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVA 140
            MSAEAFE+LKTQFDLNAET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVA
Sbjct  1    MSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVA 59
Query  141  ATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPR 177
            ATESAYLA+RN SLDL+EQELVDCASQHGCHGDTIPR
Sbjct  60   ATESAYLAHRNQSLDLAEQELVDCASQHGCHGDTIPR 96

Sequence Alignment: 30. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 123.2 bits 523,  Expect = 2e-29
 Identities = 102/273 37%, Positives = 162/273 59%, Gaps = 30/273 10%
Query  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
            I+ F+ +    NK Y +++E+    + F ++L Y+ E NK        +N ++DLS DEF
Sbjct  45   IQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLSNDEF 104
Query  76   KNRYL-MSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCW 134
            K +Y+   AE F  L+ +FD N + +   +   N P  +D R+   VTP++ QG CGSCW
Sbjct  105  KKKYVGFVAEDFTGLE-HFD-NEDFTYKHV--TNYPQSIDWRAKGAVTPVKNQGACGSCW 160
Query  135  AFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
            AFS +A  E          L+LSEQELVDC  + +GC G      ++Y+  NGV   + Y
Sbjct  161  AFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVY 220
Query  194  PYVAREQQCR---RPNSQHYGISNYCQIYPPDVK-QIREALTQTHTAIAVIIGIKDLRAF 249
            PY A++ +CR   +P  +   I+ Y ++ P + +     AL     ++ V  G K ++ +
Sbjct  221  PYQAKQYKCRATDKPGPK-VKITGYKRV-PSNCETSFLGALANQPLSVLVEAGGKPFQLY 278
Query  250  QH--YDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYF--QA 305
            +   +DG    + D       HAV  VGYG++ G +Y I++NSW   WG+ GY  +  Q+
Sbjct  279  KSGVFDGPCGTKLD-------HAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQS 331
Query  306  GNN 308
            GN+
Sbjct  332  GNS 334

Sequence Alignment: 31. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 121.9 bits 515,  Expect = 2e-29
 Identities = 84/203 41%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  109  VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 167
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
Query  168  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 218
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
Query  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIRHDNGYQPNY--HAVNIVG 275
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
Query  276  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 316
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216

Sequence Alignment: 32. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 121.5 bits 515,  Expect = 5e-29
 Identities = 121/305 39%, Positives = 171/305 56%, Gaps = 32/305 10%
Query  1    MKFVL--AIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVE 58
            MKF+L  A+ +L+ + +       IKTFE+FKK F K Y   EEE     +F E LK+VE
Sbjct  1    MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE 60
Query  59   ANKG------AINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV-NVPS 111
             + G      AIN  SD+S  EF          F  +K +           IN+  ++P 
Sbjct  61   EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME-----AAKEPLINTYGSLPQ 115
Query  112  ELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ---- 167
             +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQELVDC       
Sbjct  116  NFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDS 175
Query  168  ----HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YP 220
                +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y 
Sbjct  176  SYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQ 234
Query  221  PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNY--HAVNIVGYGS 278
               + +   + Q    +  + G  +   F++  G  ++R    Y   Y  HAV +VG+G+
Sbjct  235  SSDEDVMYTIQQHGPVVIYMHGSNNY--FRNL-GNGVLR-GVAYNDAYTDHAVILVGWGT 290
Query  279  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQY 315
             QGVDYWI+RNSW T WG+ GYGY + G+N + I  +
Sbjct  291  VQGVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNF 327

Sequence Alignment: 33. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 119.8 bits 508,  Expect = 2e-28
 Identities = 107/286 37%, Positives = 168/286 58%, Gaps = 33/286 11%
Query  4    VLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------KNYATVEEEEVARKNFLESLK 55
            +L  ++LL+LS  + A+  + +T +E K  +        K+Y ++ E E   + F E+L+
Sbjct  12   LLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLR 71
Query  56   YVEAN--------KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV 107
            +++ +        K  +N+++DL+ +EF++ YL         KT+     E    R   V
Sbjct  72   FIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSN--KTKVSNRYEP---RFGQV 126
Query  108  NVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-S 166
             +PS +D RS   V  I+ QG CG CWAFS +A  E          + LSEQEL+DC  +
Sbjct  127  -LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRT 185
Query  167  QH--GCHGDTIPRGIEYIQQNGVVE-ERSYPYVAREQQCRRP--NSQHYGISNYCQIYPP 221
            Q+  GC+G  I  G ++I  NG +  E +YPY A++ +C     N ++  I  Y  +   
Sbjct  186  QNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENVPYN 245
Query  222  DVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQG 281
            +   ++ A+T    ++A +    D  AF+HY    I     G   + HAV IVGYG+  G
Sbjct  246  NEWALQTAVTYQPVSVA-LDAAGD--AFKHYSS-GIFTGPCGTAID-HAVTIVGYGTEGG 300
Query  282  VDYWIVRNSWDTTWGDSGY 300
            +DYWIV+NSWDTTWG+ GY
Sbjct  301  IDYWIVKNSWDTTWGEEGY 319

Sequence Alignment: 34. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 118.9 bits 504,  Expect = 3e-28
 Identities = 106/286 37%, Positives = 169/286 59%, Gaps = 33/286 11%
Query  4    VLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------KNYATVEEEEVARKNFLESLK 55
            +L  ++LL+LS  + A+  + +T +E K  +        K+Y ++ E E   + F E+L+
Sbjct  12   LLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLR 71
Query  56   YVEAN--------KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSV 107
            +++ +        K  +N+++DL+ +EF++ YL         KT+     E    R+  V
Sbjct  72   FIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSN--KTKVSNRYEP---RVGQV 126
Query  108  NVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-S 166
             +PS +D RS   V  I+ QG CG CWAFS +A  E          + LSEQEL+DC  +
Sbjct  127  -LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRT 185
Query  167  QH--GCHGDTIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYPP 221
            Q+  GC+G  I  G ++I  NG +  E +YPY A++ +C     N ++  I  Y  +   
Sbjct  186  QNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYN 245
Query  222  DVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYGSTQG 281
            +   ++ A+T    ++A +    D  AF++Y    I     G   + HAV IVGYG+  G
Sbjct  246  NEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HAVTIVGYGTEGG 300
Query  282  VDYWIVRNSWDTTWGDSGY 300
            +DYWIV+NSWDTTWG+ GY
Sbjct  301  IDYWIVKNSWDTTWGEEGY 319

Sequence Alignment: 35. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 116.1 bits 491,  Expect = 2e-27
 Identities = 90/265 33%, Positives = 148/265 55%, Gaps = 26/265 9%
Query  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEA----NKGA----INHLSDLSLDE 74
            +K FEE+   + + Y   +E+    + F  ++K++E     N+ +    IN+++D++  E
Sbjct  34   MKRFEEWMAEYGRVYKDDDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTDMTKSE 93
Query  75   FKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCW 134
            F  +Y   +     L    +     S   +N   VP  +D R    V  ++ Q  CGSCW
Sbjct  94   FVAQYTGVS-----LPLNIEREPVVSFDDVNISAVPQSIDWRDYGAVNEVKNQNPCGSCW 148
Query  135  AFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYI-QQNGVVEERSY 193
            +F+ +A  E  Y       + LSEQE++DCA  +GC G  + +  ++I   NGV  E +Y
Sbjct  149  SFAAIATVEGIYKIKTGYLVSLSEQEVLDCAVSYGCKGGWVNKAYDFIISNNGVTTEENY 208
Query  194  PYVAREQQCRR---PNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ 250
            PY+A +  C     PNS +  I+ Y  +   D + +  A+  ++  IA +I   +   FQ
Sbjct  209  PYLAYQGTCNANSFPNSAY--ITGYSYVRRNDERSMMYAV--SNQPIAALIDASE--NFQ 262
Query  251  HYDGRTIIRHDNGYQPNYHAVNIVGYGS-TQGVDYWIVRNSWDTTWGDSGY 300
            +Y+G  +     G   N HA+ I+GYG  + G  YWIVRNSW ++WG+ GY
Sbjct  263  YYNG-GVFSGPCGTSLN-HAITIIGYGQDSSGTKYWIVRNSWGSSWGEGGY 311

Sequence Alignment: 36. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 113.3 bits 479,  Expect = 2e-26
 Identities = 91/276 32%, Positives = 144/276 52%, Gaps = 17/276 6%
Query  26   FEEFKKAFNKNYATVEEEEVARKN---FLESLKYVEANKGAINHLSDLSLDEFKNRYLMS 82
            ++ +++  N    + E   V + N     ES K  +  K  +N ++D++  EF N Y  S
Sbjct  40   YDRWREQHNIEMRSPERFNVFKYNVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANS 99
Query  83   AEA-FEQLKTQ----FDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFS 137
              + F+ L+       D +        N   +P ++D R    VT ++ QGGCGSCWAF+
Sbjct  100  KISHFQALRGSAPGSIDTDPNKDFIYANVTKIPDKVDWREKNAVTDVKGQGGCGSCWAFA 159
Query  138  GVAATESAYLAYRNTSLDLSEQELVDC-ASQHGCHGDTIPRGIEY-IQQNGVVEERSYPY 195
             V A E          + +SEQ+LVDC  +  GC G  +     Y I++ G+  E SYPY
Sbjct  160  AVVALEGINAIRTGKLVKFSEQQLVDCDMTNAGCDGGLMEPAFTYVIKHGGIAPEASYPY 219
Query  196  VAREQQCRRPNSQHYGISNYCQIYPP-DVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG 254
            V + + C +   +     +  Q  P  D + +R+A+   H  +A  I +     +Q Y  
Sbjct  220  VGKRETCDKAKIKDVLKIDGRQNVPGLDEEALRKAV--AHQPVATGIQLSG-HGLQFYS- 275
Query  255  RTIIRHDNGYQPNYHAVNIVGYG-STQGVDYWIVRNSWDTTWGDSGYGYFQAG 306
              +   D G +PN H V IVGYG + +G+ +W V+NSW  TWG+ GY ++Q G
Sbjct  276  EGVYTGDCGTEPN-HGVGIVGYGENEKGIKFWTVKNSWGPTWGEKGYIHLQRG 327

Sequence Alignment: 37. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 104.6 bits 439,  Expect = 6e-24
 Identities = 93/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
Query  76   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 135
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  105  KEKYTGSIAG---NYTTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
Query  136  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
Query  194  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 251
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
Query  252  YDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 306
            Y G  I     G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  277  YRG-GIFVGPCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325

Sequence Alignment: 38. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 101.4 bits 425,  Expect = 6e-23
 Identities = 93/286 32%, Positives = 146/286 51%, Gaps = 27/286 9%
Query  26   FEEFKKAFNKNYATVEEEEVARKNFLESLKYVE---ANKGA-------INHLSDLSLDEF 75
            F+ +K    + Y   EEE    + F  +  Y+    AN+ +       +N ++D++  EF
Sbjct  44   FQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEF 103
Query  76   KNRYLMSA-EAFEQLK-TQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSC 133
              +YL +  +  +Q+K     +  E  +C     + P+  D R    +T ++ QGGCG  
Sbjct  104  SKKYLQAPKDVSQQIKMANKKMKKEQYSCD----HPPASWDWRKKGVITQVKYQGGCGRG 159
Query  134  WAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-HGCHGDTIPRGIEYI-QQNGVVEER 191
            WAFS   A E+A+       + LSEQELVDC  +  G +     +  E++ ++ G+  + 
Sbjct  160  WAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDD 219
Query  192  SYPYVAREQQCRRPNSQ-HYGISNYCQIYPPDVKQIREALTQTHTAI---AVIIGIKDLR 247
             YPY A+E +C+    Q    I  Y  +   D     E      +AI    + + I D +
Sbjct  220  DYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSI-DAK 278
Query  248  AFQHYDGRTIIRHDNGYQPN--YHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQA 305
             F+ Y G  I   +N   P    H V +VGYGS  GVDYWI +NSW   WG+ GY + Q 
Sbjct  279  DFHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQR 337
Query  306  GN-NLMMIEQYPY 317
               NL+ +    Y
Sbjct  338  NTGNLLGVCGMNY 350

Sequence Alignment: 39. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 101.2 bits 424,  Expect = 7e-23
 Identities = 93/286 32%, Positives = 146/286 51%, Gaps = 27/286 9%
Query  26   FEEFKKAFNKNYATVEEEEVARKNFLESLKYVE---ANKGA-------INHLSDLSLDEF 75
            F+ +K    + Y   EEE    + F  +  Y+    AN+ +       +N ++D++  EF
Sbjct  44   FQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEF 103
Query  76   KNRYLMSA-EAFEQLK-TQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSC 133
              +YL +  +  +Q+K     +  E  +C     + P+  D R    +T ++ QGGCG  
Sbjct  104  SKKYLQAPKDVSQQIKMANKKMKKEQYSCD----HPPASWDWRKKGVITQVKYQGGCGRG 159
Query  134  WAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-HGCHGDTIPRGIEYI-QQNGVVEER 191
            WAFS   A E+A+       + LSEQELVDC  +  G +     +  E++ ++ G+  + 
Sbjct  160  WAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDD 219
Query  192  SYPYVAREQQCRRPNSQ-HYGISNYCQIYPPDVKQIREALTQTHTAI---AVIIGIKDLR 247
             YPY A+E +C+    Q    I  Y  +   D     E      +AI    + + I D +
Sbjct  220  DYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSI-DAK 278
Query  248  AFQHYDGRTIIRHDNGYQPN--YHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQA 305
             F+ Y G  I   +N   P    H V +VGYGS  GVDYWI +NSW   WG+ GY + Q 
Sbjct  279  DFHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGFDWGEDGYIWIQR 337
Query  306  GN-NLMMIEQYPY 317
               NL+ +    Y
Sbjct  338  NTGNLLGVCGMNY 350

Sequence Alignment: 40. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 67.0 bits 269,  Expect = 1e-12
 Identities = 110/289 38%, Positives = 160/289 55%, Gaps = 34/289 11%
Query  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNRYLMS 82
            + T+E++K  F KNY T+ EE   + N++ SL  +  N G  N ++ L L++  +    S
Sbjct  23   VPTWEQYKVKFGKNYLTINEENFRKNNYFNSLTKIVKNNGK-NGVT-LGLNDMSD---WS 77
Query  83   AEAFEQLKTQFDLNAETSACRINSVNV---PSELDLRSLRTVTPIRMQGGCGSCWAFSGV 139
             E F  L ++   +   SA   ++VN    P   D R++     I  QG C SCWAF+  
Sbjct  78   DEEFFSLNSKSPSSVFVSARPTSTVNTSPFPKSWDWRNIIAFNSIEQQGRCSSCWAFAAA 137
Query  140  AATESAYLAYRNT-SLDLSEQELVDCAS----QH----GCHGDTIPRGIEYIQQNGVVEE 190
               E+AY   +N  +L LS QELVDC +    QH    GC G       +YI  +GV E+
Sbjct  138  TTVEAAYAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGCKGGWPTEAYKYIMDHGVYED 197
Query  191  RSYPYVAREQQ-CRRPNSQH-------YGISNYCQIYPPDVKQIREALTQTHTAIAVII- 241
            + Y Y     + C      H       Y ISNY ++   D  +   A+  T+    V I 
Sbjct  198  KLYHYTETFNEVCYADKVAHDKGHPVKYYISNYGRLAYNDTDEAIMAMLVTYGPGTVDIH 257
Query  242  GIKDLRAFQHYDGRTIIRH--DNGYQPNYHAVNIVGYGS-TQGVDYWIVRNSWDTTWGDS 298
            G  D   F+ Y G  I+R+   N    N H V +VGYG+ + GVDYWI+RNSW  TWG+ 
Sbjct  258  GTSD--TFRFYKG-GIMRNVMPNSAYTN-HIVVVVGYGTDSSGVDYWIIRNSWGKTWGEH 313
Query  299  GYGYFQAGNNLMMIE-QYPYVVI 320
            GYG ++   NL+    +Y Y ++
Sbjct  314  GYGRLERHPNLLGFNNKYNYPIL 336

Sequence Alignment: 41. Allergen Name: Der m 1 Sequence ID: P16312

 Score = 49.3 bits 177,  Expect = 2e-08
 Identities = 28/30 93%, Positives = 28/30 93%, Gaps = 0/30 0%
Query  99   TSACRINSVNVPSELDLRSLRTVTPIRMQG 128
            T ACRINS NVPSELDLRSLRTVTPIRMQG
Sbjct  1    TQACRINSGNVPSELDLRSLRTVTPIRMQG 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.