The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKIFVPLLSFLLAGLTTGLDWWEHGNFYQVYPRSFKDSDGDGIGDLDGVTEKLKYLKDIG
MDGVWLSPIFSSPMADFGYDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLILDFVPNHT
SDQHEYFKKSVQKDETYKDFYVWHPGVHGPNNTKVPPSNWISVFRGSSWEWNEERQEFYL
HQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRIDAVPYLFESDIIDGRYRNEPES
RTTDDPENPAYLVHTQTMDQPETYDMIYQWRAVLDEYSKTDNRTRIMMTEGYTSLPKIIE
FFGNATANGAQIPFNFEVISNVKKNSTGADFATYVKRWLDAKPANRRSNWVLGNHDNNRL
GSRLGENKIDLYNIALQTLPDIAVTYYGEEIGMLDQWIPWNETVDPAACRSDEASYSAYS
RDPARTPMQWDSGKNAGFSKAAKTWLPVADNYKTLNVKIQDRARKSHLKIFKKLTKYRKR
QILTEGDIDIKVSGENLLVYKRKVDKVGYVVVALNFGTEPVALGLSSLFDRADQRMQVVV
SSNRVSTPDNVWVDVDNYVLIGESGIVLQYLWGKNPIVS
Sequence Info Allergen Name Length Opt Bits Score E Value
P13080 Aed a 4.0101 579 3955 907.7 0
AHX03180 Der f 4.0101 525 182 47.7 2.2e-06
AAD38942 Der p 4 496 177 46.6 4.5e-06
AAD38943 Eur m 4.0101 521 174 45.9 7.6e-06
AAQ24543 Blo t 4.0101 506 155 41.6 0.00015
AAA32708 Asp o 21 499 151 40.6 0.00027
BAA00336 Asp o 21 499 151 40.6 0.00027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Aed a 4.0101 Sequence ID: P13080

 Score = 907.7 bits 3955,  Expect = 0
 Identities = 579/579 100%, Positives = 579/579 100%, Gaps = 0/579 0%
Query  1    MKIFVPLLSFLLAGLTTGLDWWEHGNFYQVYPRSFKDSDGDGIGDLDGVTEKLKYLKDIG 60
            MKIFVPLLSFLLAGLTTGLDWWEHGNFYQVYPRSFKDSDGDGIGDLDGVTEKLKYLKDIG
Sbjct  1    MKIFVPLLSFLLAGLTTGLDWWEHGNFYQVYPRSFKDSDGDGIGDLDGVTEKLKYLKDIG 60
Query  61   MDGVWLSPIFSSPMADFGYDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLILDFVPNHT 120
            MDGVWLSPIFSSPMADFGYDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLILDFVPNHT
Sbjct  61   MDGVWLSPIFSSPMADFGYDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLILDFVPNHT 120
Query  121  SDQHEYFKKSVQKDETYKDFYVWHPGVHGPNNTKVPPSNWISVFRGSSWEWNEERQEFYL 180
            SDQHEYFKKSVQKDETYKDFYVWHPGVHGPNNTKVPPSNWISVFRGSSWEWNEERQEFYL
Sbjct  121  SDQHEYFKKSVQKDETYKDFYVWHPGVHGPNNTKVPPSNWISVFRGSSWEWNEERQEFYL 180
Query  181  HQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRIDAVPYLFESDIIDGRYRNEPES 240
            HQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRIDAVPYLFESDIIDGRYRNEPES
Sbjct  181  HQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRIDAVPYLFESDIIDGRYRNEPES 240
Query  241  RTTDDPENPAYLVHTQTMDQPETYDMIYQWRAVLDEYSKTDNRTRIMMTEGYTSLPKIIE 300
            RTTDDPENPAYLVHTQTMDQPETYDMIYQWRAVLDEYSKTDNRTRIMMTEGYTSLPKIIE
Sbjct  241  RTTDDPENPAYLVHTQTMDQPETYDMIYQWRAVLDEYSKTDNRTRIMMTEGYTSLPKIIE 300
Query  301  FFGNATANGAQIPFNFEVISNVKKNSTGADFATYVKRWLDAKPANRRSNWVLGNHDNNRL 360
            FFGNATANGAQIPFNFEVISNVKKNSTGADFATYVKRWLDAKPANRRSNWVLGNHDNNRL
Sbjct  301  FFGNATANGAQIPFNFEVISNVKKNSTGADFATYVKRWLDAKPANRRSNWVLGNHDNNRL 360
Query  361  GSRLGENKIDLYNIALQTLPDIAVTYYGEEIGMLDQWIPWNETVDPAACRSDEASYSAYS 420
            GSRLGENKIDLYNIALQTLPDIAVTYYGEEIGMLDQWIPWNETVDPAACRSDEASYSAYS
Sbjct  361  GSRLGENKIDLYNIALQTLPDIAVTYYGEEIGMLDQWIPWNETVDPAACRSDEASYSAYS 420
Query  421  RDPARTPMQWDSGKNAGFSKAAKTWLPVADNYKTLNVKIQDRARKSHLKIFKKLTKYRKR 480
            RDPARTPMQWDSGKNAGFSKAAKTWLPVADNYKTLNVKIQDRARKSHLKIFKKLTKYRKR
Sbjct  421  RDPARTPMQWDSGKNAGFSKAAKTWLPVADNYKTLNVKIQDRARKSHLKIFKKLTKYRKR 480
Query  481  QILTEGDIDIKVSGENLLVYKRKVDKVGYVVVALNFGTEPVALGLSSLFDRADQRMQVVV 540
            QILTEGDIDIKVSGENLLVYKRKVDKVGYVVVALNFGTEPVALGLSSLFDRADQRMQVVV
Sbjct  481  QILTEGDIDIKVSGENLLVYKRKVDKVGYVVVALNFGTEPVALGLSSLFDRADQRMQVVV 540
Query  541  SSNRVSTPDNVWVDVDNYVLIGESGIVLQYLWGKNPIVS 579
            SSNRVSTPDNVWVDVDNYVLIGESGIVLQYLWGKNPIVS
Sbjct  541  SSNRVSTPDNVWVDVDNYVLIGESGIVLQYLWGKNPIVS 579

Sequence Alignment: 2. Allergen Name: Der f 4.0101 Sequence ID: AHX03180

 Score = 47.7 bits 182,  Expect = 2e-06
 Identities = 61/215 28%, Positives = 119/215 55%, Gaps = 35/215 16%
Query  3    IFVPLLSFLLAGLTTGLDWWEHGNFYQVYPRS----FKDSDGDGIGDLDGVTEKLKYLKD 58
            I++ +L++L++ +  G   + + +F  +  RS    + +   D IGD     E  ++L  
Sbjct  8    ILITVLTLLVSLFVNGDSKFSNPHF--IGNRSVITHLMEWKYDDIGD-----ECERFLGP 60
Query  59   IGMDGVWLSPIFSSPMADFG------YDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLI 112
             G  GV +SP+    + D G      Y   ++ +I+T  GD   F+R+  +C + G+ + 
Sbjct  61   YGYGGVQVSPVNEHAIMD-GRPWYERYQPVSY-DIHTRSGDEQQFRRMVQRCNKAGVRIY 118
Query  113  LDFVPNHTSDQHEYFKKSVQKDETYKDFYVWHPGV-HGPNNT---KVPPSNWISVFRGSS 168
            +D V NH +  +  +  + +    Y    + +PGV  GPN+    +  P+N + +   S+
Sbjct  119  VDIVLNHMTGGQSGLGTNGHH---YDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSN 175
Query  169  WEWNEERQEFYLHQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRIDAVPYLFESD 228
                  R E    +++  + DL  ++  V ++  + L + +D GV+GFR DA  + +  D
Sbjct  176  ------RIEARNCRLVGLR-DLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDD 228
Query  229  I--IDGRYRN 236
            +  I  R  N
Sbjct  229  LRSIYSRLHN 238

Sequence Alignment: 3. Allergen Name: Der p 4 Sequence ID: AAD38942

 Score = 46.6 bits 177,  Expect = 4e-06
 Identities = 56/203 27%, Positives = 99/203 48%, Gaps = 22/203 10%
Query  41   DGIGDLDGVTEKLKYLKDIGMDGVWLSPIFSSPMADFGYDISNFR----EIQTEYGDLDA 96
            D IGD     E  ++L   G  GV +SP+    + D       ++    +I+T  GD   
Sbjct  23   DDIGD-----ECERFLGPYGYGGVQVSPVNEHAILDRRPWYERYQPVSYDIRTRSGDEQQ 77
Query  97   FQRLSDKCKQLGLHLILDFVPNHTSDQHEYFKKSVQKDETYKDFYVWHPGV-HGPNNTKV 155
            F+R+  +C + G+ + +D V NH +  +    K       Y    + +PGV  GPN+   
Sbjct  78   FRRMVKRCNKAGVRIYVDIVLNHMTGAQS--GKGTNGHH-YDGNTLQYPGVPFGPNDFHG 134
Query  156  PPSNWISVFRGSSWEWNEERQEFYLHQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSG 215
              S     +    +   +E +   L   L+   DL  ++  V ++  + L + +D GV+G
Sbjct  135  HESCPTQDLEIHDYTNPKEARNCRLSG-LR---DLKQQSEYVRQKQVDFLNHLIDIGVAG 190
Query  216  FRIDAVPYLFESDI--IDGRYRNEPESRTTDDPENPAYLVHTQTM 258
            FR DA  + +  D+  I  R  N  +      PEN   +++ +T+
Sbjct  191  FRSDASTHQWPDDLRSIYSRLHNLNKEFF---PENSQPFIYHETI 232

Sequence Alignment: 4. Allergen Name: Eur m 4.0101 Sequence ID: AAD38943

 Score = 45.9 bits 174,  Expect = 8e-06
 Identities = 48/176 27%, Positives = 86/176 48%, Gaps = 19/176 10%
Query  41   DGIGDLDGVTEKLKYLKDIGMDGVWLSPIFSSPMADFGYDISNFR----EIQTEYGDLDA 96
            D IGD     E  ++L   G  GV +SP+    + D       ++    +++T  GD   
Sbjct  48   DDIGD-----ECERFLGPYGYGGVQVSPVNEHAILDRRPWYERYQPVSYDLRTRSGDEQQ 102
Query  97   FQRLSDKCKQLGLHLILDFVPNHTSDQHEYFKKSVQKDETYKDFYVWHPGV-HGPNNTKV 155
            F+R+  +C + G+ + +D V NH +  +            Y    + +PGV  GPN+   
Sbjct  103  FRRMVKRCNKAGVRIYVDIVLNHMTGGQ---SGQGTNGNHYNGITMQYPGVPFGPNDFHG 159
Query  156  PPSNWISVFRGSSW-EWNEERQEFYLHQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVS 214
              S     +   ++ + NE R     +  L    DL  ++  V ++  + L + +D GV+
Sbjct  160  HESCQTKDLEIHNYSDRNEAR-----NCRLSGLRDLKQQSEYVRKKQVDFLNHLIDIGVA 214
Query  215  GFRIDAVPYLFESDI 229
            GFR DA  + +  D+
Sbjct  215  GFRSDASTHQWPDDL 229

Sequence Alignment: 5. Allergen Name: Blo t 4.0101 Sequence ID: AAQ24543

 Score = 41.6 bits 155,  Expect = 0.0001
 Identities = 45/175 25%, Positives = 83/175 47%, Gaps = 16/175 9%
Query  46   LDGVTEKLKYLKDIGMDGVWLSPIFSSPMADFG-----YDISNFREIQTEYGDLDAFQRL 100
            +D   E  ++L   G  GV +SP+      D       Y   ++R I +  G    F+ +
Sbjct  45   VDIADECERFLGPYGYGGVQVSPVNEHASLDRHPWYELYQPVSYR-IVSRSGTESQFRDM 103
Query  101  SDKCKQLGLHLILDFVPNHTSDQHEYFKKSVQKDETYKDFY-VWHPGV-HGPNNTKVPPS 158
              +C + G+ + +D V NH +      +  V  D T+ D   + +PG+  GPN+     S
Sbjct  104  VHRCNKAGVRIYVDVVLNHMTGP----QSGVGIDGTHYDGNSMQYPGIPFGPNDFHGHES 159
Query  159  NWISVFRGSSWEWNEERQEFYLHQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRI 218
               S +   +++   + +   L  +     DL      V  +  + L + +D GV+GFR 
Sbjct  160  CPTSNLDIQNYDDPTQARNCRLSGLR----DLKQSADYVRTKQADFLNHLIDIGVAGFRF 215
Query  219  DAVPYLFESDI 229
            DA  +++  D+
Sbjct  216  DASKHMWPGDL 226

Sequence Alignment: 6. Allergen Name: Asp o 21 Sequence ID: AAA32708

 Score = 40.6 bits 151,  Expect = 0.0003
 Identities = 83/338 24%, Positives = 144/338 42%, Gaps = 62/338 18%
Query  17   TGLDWWEHGNFYQVYPRSFKDSDGDGI------------GDLDGVTEKLKYLKDIGMDGV 64
            T  DW  +  ++ +  R F  +DG               G   G+ +KL Y++ +G   +
Sbjct  23   TPADWRSQSIYFLLTDR-FARTDGSTTATCNTADQKYCGGTWQGIIDKLDYIQGMGFTAI 81
Query  65   WLSPIFSS-PM------ADFGYDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLILDFVP 117
            W++P+ +  P       A  GY   +   +   YG  D ++ LS    + G++L++D V 
Sbjct  82   WITPVTAQLPQTTAYGDAYHGYWQQDIYSLNENYGTADDLKALSSALHERGMYLMVDVVA 141
Query  118  NHTS--DQHEYFKKSVQKDETYKDFYVWHPGVHGPNNTKVPPSNWISVFRGSSWEWNEER 175
            NH            SV K  + +D++  HP     N                 +E   + 
Sbjct  142  NHMGYDGAGSSVDYSVFKPFSSQDYF--HPFCLIQN-----------------YEDQTQV 182
Query  176  QEFYLHQFLKEQPDLNYRNPAVVEEMKN-VLRYWLDRGVSGFRIDAVPYLFESDIIDGRY 234
            ++ +L       PDL+     V  E  + V     +  + G+RID V ++ + D   G  
Sbjct  183  EDCWLGDNTVSLPDLDTTKDVVKNEWYDWVGSLVSNYSIDGLRIDTVKHV-QKDFWPGYN 241
Query  235  RNEPE---SRTTDDPENPAYLVHTQT-MDQPETYDMIYQWRAVLDEYSKTDNRTRIMMTE 290
            +           D   +PAY    Q  MD    Y + Y     +   S + +    M+  
Sbjct  242  KAAGVYCIGEVLDG--DPAYTCPYQNVMDGVLNYPIYYPLLNAFKSTSGSMHDLYNMINT 299
Query  291  GYTSLPKIIEFFGNATANGAQIPF-----NFEVISNVKKNSTGAD-----FATYVKRWLD 340
              +  P    ++G    N     F     +  +  NV       D     +A   + +  
Sbjct  300  VKSDCPDST-LLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIYAGQEQHYAG 358
Query  341  AK-PANRRSNWVLGNHDNNRLGSRLGE-NKIDLYNIALQT 378
               PANR + W  G   ++ L   +   N I  Y I+  T
Sbjct  359  GNDPANREATWASGYPTDSELYKLIASANAIRNYAISKDT 398

Sequence Alignment: 7. Allergen Name: Asp o 21 Sequence ID: BAA00336

 Score = 40.6 bits 151,  Expect = 0.0003
 Identities = 36/126 28%, Positives = 64/126 50%, Gaps = 24/126 19%
Query  17   TGLDWWEHGNFYQVYPRSFKDSDGDGI------------GDLDGVTEKLKYLKDIGMDGV 64
            T  DW  +  ++ +  R F  +DG               G   G+ +KL Y++ +G   +
Sbjct  23   TPADWRSQSIYFLLTDR-FARTDGSTTATCNTADQKYCGGTWQGIIDKLDYIQGMGFTAI 81
Query  65   WLSPIFSS-PM------ADFGYDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLILDFVP 117
            W++P+ +  P       A  GY   +   +   YG  D ++ LS    + G++L++D V 
Sbjct  82   WITPVTAQLPQTTAYGDAYHGYWQQDIYSLNENYGTADDLKALSSALHERGMYLMVDVVA 141
Query  118  NHTS--DQHEYFKKSVQKDETYKDFYVWHP 145
            NH            SV K  + +D++  HP
Sbjct  142  NHMGYDGAGSSVDYSVFKPFSSQDYF--HP 169

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.