The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ
LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q25456 Met e 1 274 1660 385.0 1.6e-108
EU410072 Lit v 1.0101 284 1650 382.7 7.9e-108
AAX37288 Pen m 1 284 1650 382.7 7.9e-108
11893851 Pen a 1 284 1650 382.7 7.9e-108
AAC48288 Hom a 1.0102 284 1630 378.1 1.9e-106
D3XNR9 Mac r 1.0101 284 1628 377.7 2.6e-106
O61379 Pan s 1 274 1626 377.2 3.3e-106
M1H607 Por p 1.0101 284 1615 374.7 2e-105
C0LU07 Pro c 1.0101 284 1607 372.9 7.1e-105
CBY17558 Pan b 1.0101 284 1602 371.8 1.6e-104
M4M2H6 Mel l 1.0101 284 1576 365.8 9.4e-103
O44119 Hom a 1.0101 284 1542 358.1 2e-100
A7L5V2 Scy p 1.0101 284 1537 356.9 4.5e-100
Q9N2R3 Cha f 1 264 1403 326.4 6.4e-91
AEX31649 Cho a 10.0101 284 1388 323.0 7.5e-90
BAA04557 Der f 10.0101 299 1384 322.1 1.5e-89
Q9NFZ4 Lep d 10 284 1375 320.0 5.9e-89
AAF72534 Bla g 7.0101 284 1374 319.8 6.9e-89
AAD19606 Per a 7.0102 284 1374 319.8 6.9e-89
NP_001103782 Bomb m 3.0101 285 1374 319.8 6.9e-89
ABU97466 Blo t 10.0101 284 1373 319.6 8e-89
Q9UB83 Per a 7 284 1370 318.9 1.3e-88
O18416 Der p 10 284 1364 317.5 3.3e-88
AAT40866 Tyr p 10.0101 284 1346 313.4 5.7e-87
Q17H75 Aed a 10.0101 285 1338 311.6 2e-86
CAA09938 Chi k 10 285 1295 301.8 1.8e-83
Q9NAS5 Ani s 3 284 1238 288.8 1.5e-79
ACN32322 Asc l 3.0101 287 1235 288.1 2.4e-79
AGM32377.1 Copt f 7.0101 256 1214 283.4 5.7e-78
CAC84590 Lep s 1 284 1144 267.4 4.2e-73
CAB38044 Hel as 1 284 1093 255.7 1.3e-69
Q17H80 Aed a 10.0201 284 1085 253.9 4.6e-69
APG42675 Hal l 1.0101 284 1077 252.1 1.6e-68
AAG08987 Hal d 1 284 1064 249.1 1.3e-67
AVD53650 Sac g 1.0101 284 1036 242.7 1.1e-65
AAG08989 Mim n 1 284 963 226.1 1.1e-60
NP_001117128 Sal s 4.0101 284 947 222.5 1.4e-59
AAG08988 Per v 1 284 945 222.0 1.9e-59
XP_026775428 Pan h 4.0201 284 945 222.0 1.9e-59
AAK96889 Cra g 1 233 932 219.1 1.1e-58
XP_026781482 Pan h 4.0101 284 875 206.0 1.2e-54
AAK39511 Der f 11.0101 692 243 61.8 7.7e-11
AAM83103 Blo t 11 875 212 54.7 1.3e-08
QPB41107 Rap v 2.0101 859 204 52.9 4.6e-08
AAO73464 Der p 11 875 192 50.2 3.1e-07
AAF72796 Ani s 2 869 187 49.0 6.8e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 385.0 bits 1660,  Expect = 2e-108
 Identities = 274/274 100%, Positives = 274/274 100%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 2. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 382.7 bits 1650,  Expect = 8e-108
 Identities = 273/274 99%, Positives = 273/274 99%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 3. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 382.7 bits 1650,  Expect = 8e-108
 Identities = 273/274 99%, Positives = 273/274 99%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 4. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 382.7 bits 1650,  Expect = 8e-108
 Identities = 273/274 99%, Positives = 273/274 99%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 5. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 378.1 bits 1630,  Expect = 2e-106
 Identities = 270/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 6. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 377.7 bits 1628,  Expect = 3e-106
 Identities = 269/274 98%, Positives = 271/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLD VQE+LLKAN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSVQEALLKANQH 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 7. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 377.2 bits 1626,  Expect = 3e-106
 Identities = 269/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 8. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 374.7 bits 1615,  Expect = 2e-105
 Identities = 267/274 97%, Positives = 269/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKD+AMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKS TDELDQ FSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 9. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 372.9 bits 1607,  Expect = 7e-105
 Identities = 265/273 97%, Positives = 269/273 98%, Gaps = 0/273 0%
Query  2    KLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQL 61
            KLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQ+LENDLDQVQESLLKAN QL
Sbjct  12   KLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQVQESLLKANTQL 71
Query  62   VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLE 121
             EKDKA+SNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLE
Sbjct  72   EEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLE 131
Query  122  NRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIV 181
            NRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIV
Sbjct  132  NRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIV 191
Query  182  ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQK 241
            ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQK
Sbjct  192  ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQK 251
Query  242  EVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            EVDRLEDELVNEKEKYKSITDELDQTFSEL+GY
Sbjct  252  EVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 10. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 371.8 bits 1602,  Expect = 2e-104
 Identities = 265/274 96%, Positives = 269/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEV  LQK++QQLENDLD VQE+LLKAN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSVQEALLKANQH 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 365.8 bits 1576,  Expect = 9e-103
 Identities = 260/274 94%, Positives = 268/274 97%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+DQVQE+LL AN  
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALLLANTN 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
             VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   AVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 358.1 bits 1542,  Expect = 2e-100
 Identities = 255/274 93%, Positives = 263/274 95%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   +K+MQQ+EN+LDQVQE L  AN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQVQEQLSLANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 356.9 bits 1537,  Expect = 4e-100
 Identities = 253/274 92%, Positives = 261/274 95%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ QE L  AN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLSAANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 326.4 bits 1403,  Expect = 6e-91
 Identities = 232/254 91%, Positives = 240/254 94%, Gaps = 0/254 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ QE L  AN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLSAANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL NAEGEVAALNRRIQL EEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEK 254
            KEVDRLEDELVNEK
Sbjct  251  KEVDRLEDELVNEK 264

Sequence Alignment: 15. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 323.0 bits 1388,  Expect = 8e-90
 Identities = 222/274 81%, Positives = 254/274 92%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LDQVQES+ +AN +
Sbjct  11   MKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESFTQANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AADESERMRK+L
Sbjct  71   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  EHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 16. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 322.1 bits 1384,  Expect = 2e-89
 Identities = 223/274 81%, Positives = 251/274 91%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA+  EQ+ ++AN RAEKSEEEV  LQK++QQ+EN+LDQVQE L  AN +
Sbjct  26   MKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQVQEQLSAANTK 85
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+ADESERMRK+L
Sbjct  86   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKML 145
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  146  EHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 205
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  206  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ 265
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  266  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 17. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 320.0 bits 1375,  Expect = 6e-89
 Identities = 220/274 80%, Positives = 254/274 92%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQVQESL +AN +
Sbjct  11   MKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQESLTQANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+ADESERMRK+L
Sbjct  71   LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  EHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 18. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 319.8 bits 1374,  Expect = 7e-89
 Identities = 224/273 82%, Positives = 245/273 89%, Gaps = 0/273 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRA   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAADESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSG 273
            KEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  251  KEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 319.8 bits 1374,  Expect = 7e-89
 Identities = 224/273 82%, Positives = 246/273 90%, Gaps = 0/273 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMDRA   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAADESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSG 273
            KEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  251  KEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 20. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 319.8 bits 1374,  Expect = 7e-89
 Identities = 226/271 83%, Positives = 243/271 89%, Gaps = 0/271 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LDQ QESL++ N +
Sbjct  11   MKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLMQVNGK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAADESER RKVL
Sbjct  71   LEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESERARKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  131  ENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271
            KEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  251  KEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 21. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 319.6 bits 1373,  Expect = 8e-89
 Identities = 219/274 79%, Positives = 254/274 92%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQVQESL +AN +
Sbjct  11   MKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQVQESLTQANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+K+L  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS++ADESERMRK+L
Sbjct  71   LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RS++DEERMD LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGE+KI
Sbjct  131  EHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGETKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSV+KLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAEFAERSVRKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 22. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 318.9 bits 1370,  Expect = 1e-88
 Identities = 223/274 81%, Positives = 246/274 89%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMD A   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQA DESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAVDESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYK I D+LD TF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 317.5 bits 1364,  Expect = 3e-88
 Identities = 220/274 80%, Positives = 250/274 91%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA+  EQ+ ++AN RAEKSEEEV  LQK++QQ+EN+LDQVQE L  AN +
Sbjct  11   MKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQVQEQLSAANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+ADESERMRK+L
Sbjct  71   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RS++DEERM+ LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  EHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEA+++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEV RLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 313.4 bits 1346,  Expect = 6e-87
 Identities = 214/274 78%, Positives = 253/274 92%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLE+DNA+DRA+  EQ+ ++AN ++EK+EEEV  LQK++QQ+EN+LDQVQE+L +A  +
Sbjct  11   MKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQVQENLTQATTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL  AE +VAALNRRIQL+EEDLERSEERL  AT KL EAS++ADESERMRK+L
Sbjct  71   LEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RS++DEERMD LE+QLKEAR++AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  131  EHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T+KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKY+SI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 25. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 311.6 bits 1338,  Expect = 2e-86
 Identities = 219/271 80%, Positives = 239/271 88%, Gaps = 0/271 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA   EQQ ++AN RAEK+EEE   LQK++Q +ENDLDQ QE+L+  N +
Sbjct  11   MKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL +AT KL+EAS AADESER RKVL
Sbjct  71   LEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAADESERARKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENR+L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE GE KI
Sbjct  131  ENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAEAGEGKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271
            KEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  251  KEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 301.8 bits 1295,  Expect = 2e-83
 Identities = 214/271 78%, Positives = 234/271 86%, Gaps = 0/271 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA+DRA   E Q ++AN RAEK+EEE   LQK++Q +ENDLDQ Q      N +
Sbjct  11   MKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQTQGQETLVNGK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L  K+KAL NAE EVAALNRRIQLL EDL+RSEERL +AT KL+EAS AADESER RK+L
Sbjct  71   LEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAEERAE GE+KI
Sbjct  131  ENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271
            KEVDRLEDELV+EKEKY+ I D+LD  F EL
Sbjct  251  KEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 288.8 bits 1238,  Expect = 1e-79
 Identities = 197/274 71%, Positives = 237/274 86%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ QE L  AN+ 
Sbjct  11   MKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSTANSN 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ ADESER+RKV+
Sbjct  71   LEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTADESERVRKVM 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAEERAETGE+KI
Sbjct  131  ENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAEERAETGENKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  251  KEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 288.1 bits 1235,  Expect = 2e-79
 Identities = 197/274 71%, Positives = 237/274 86%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ QE L  AN+ 
Sbjct  11   MKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSVANSN 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ ADESER+RKV+
Sbjct  71   LEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTADESERVRKVM 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKLAMVEADLERAEERAE GE+KI
Sbjct  131  ENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  251  KEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 283.4 bits 1214,  Expect = 6e-78
 Identities = 198/241 82%, Positives = 217/241 90%, Gaps = 0/241 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDN MDRA   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAADESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  K 241
            K
Sbjct  251  K 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 267.4 bits 1144,  Expect = 4e-73
 Identities = 184/274 67%, Positives = 228/274 83%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNAMD+AD LE Q ++AN +A+K  EEV++L+K+  Q+E D+   +E+L  AN  
Sbjct  11   MKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTTKENLATANKN 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L +K+K L+N E EVA+LNR++Q++EE+LERSEERL TA TKL EAS+AADE+ RM KVL
Sbjct  71   LEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAADEASRMCKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE+R ++G+SKI
Sbjct  131  ENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAEDRVKSGDSKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGN+LKSLEVSEEKANQR E YK QIKTLT KLK AEARAE+AE+ V+KLQ
Sbjct  191  MELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAEYAEKYVKKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL   K++Y+++ DE+DQTF+ELSGY
Sbjct  251  KEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 255.7 bits 1093,  Expect = 1e-69
 Identities = 172/274 62%, Positives = 222/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D + E LL AN +
Sbjct  11   MKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AADESER RKVL
Sbjct  71   LEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAADESERGRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE R E  E+KI
Sbjct  131  ESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAEARLEAAEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  251  KEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 32. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 253.9 bits 1085,  Expect = 5e-69
 Identities = 177/274 64%, Positives = 221/274 80%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MKLEKDNA D+ADT E Q KEAN RA+K  EEV  L KR+ Q+  D ++ + +L +AN  
Sbjct  11   MKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKFKNTLEQANKD 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EK+K L++ E  VAAL R++Q +EEDLE+SEER   A +KL EA+Q+ADE+ RM KVL
Sbjct  71   LEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSADENNRMCKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE+R ++GE+KI
Sbjct  131  ENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVKSGEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGN+LKSLEVSE+KANQR E +K Q+K+LT KLK AE RAE AE++V+KLQ
Sbjct  191  MELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAENAEKNVKKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLED+L+NEK+KYK+I D+LD TF+EL+GY
Sbjct  251  KEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 252.1 bits 1077,  Expect = 2e-68
 Identities = 171/274 62%, Positives = 223/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V E L +A  +
Sbjct  11   MKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQEAMTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AADESER RKVL
Sbjct  71   LETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAADESERGRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE R E  E+KI
Sbjct  131  ESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 249.1 bits 1064,  Expect = 1e-67
 Identities = 169/274 61%, Positives = 222/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V E L +A  +
Sbjct  11   MKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQEAMAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AADESER  +VL
Sbjct  71   LETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAADESERGARVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE R E  E+KI
Sbjct  131  ESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 242.7 bits 1036,  Expect = 1e-65
 Identities = 165/274 60%, Positives = 213/274 77%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EK+NA DRA+ LEQQ ++   +  K EE++  LQK+   LEN++D V E       +
Sbjct  11   MKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIVNEKYQDCQAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
              E +K  S +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AADESER RKVL
Sbjct  71   YEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAADESERNRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            EN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DLERAE R E  E+K+
Sbjct  131  ENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAEARLEAAEAKV 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            ++LEE+L VVGNN+K+L+V  ++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  IDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 226.1 bits 963,  Expect = 1e-60
 Identities = 154/274 56%, Positives = 205/274 74%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V E L +AN +
Sbjct  11   MKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQEANTK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AADESER RKVL
Sbjct  71   LENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAADESERNRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE R E  ++K+
Sbjct  131  EGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAETRLEAADAKV 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA  AER V KLQ
Sbjct  191  LELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVVKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  251  KEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 222.5 bits 947,  Expect = 1e-59
 Identities = 151/272 55%, Positives = 211/272 77%, Gaps = 0/272 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD+  ESL  A  +
Sbjct  11   LKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKYSESLKDAQEK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AADESER  KV+
Sbjct  71   LEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVI 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER EERAE  E K 
Sbjct  131  ENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKC 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
             ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAEFAERSV KL+
Sbjct  191  SELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLE 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272
            K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  251  KTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 38. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 222.0 bits 945,  Expect = 2e-59
 Identities = 150/274 54%, Positives = 204/274 74%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            MK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D     L     +
Sbjct  11   MKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNCNTQLQDVQAK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
                +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AADESER RKVL
Sbjct  71   YERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAADESERNRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            EN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE R E  E+K+
Sbjct  131  ENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAEARLEAAEAKV 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            ++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA  AER+V KLQ
Sbjct  191  IDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  251  KEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 39. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 222.0 bits 945,  Expect = 2e-59
 Identities = 150/272 55%, Positives = 211/272 77%, Gaps = 0/272 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            +KL+K+NA+DRA+  E   K A +R+++ E+++  LQK+++  E++LD+  E+L  A  +
Sbjct  11   LKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKYSEALKDAQEK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA  KL EA +AADESER  KV+
Sbjct  71   LELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENR+L DEE+M+  E QLKEA+ +AEEADRKY+EVARKL +VE +LER EERAE  E K 
Sbjct  131  ENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSEGKC 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
             ELEEEL+ V N LKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAEFAER+V KL+
Sbjct  191  AELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLE 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272
            K +D LEDEL ++K KYK+I++ELD+ +++++
Sbjct  251  KTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 219.1 bits 932,  Expect = 1e-58
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  47   LDQVQESLLKANNQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 106
            +D V E   +   ++ E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  107  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 166
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  167  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 226
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  227  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 206.0 bits 875,  Expect = 1e-54
 Identities = 141/272 51%, Positives = 201/272 73%, Gaps = 0/272 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            +K +K+NA DRA+  E   K + ++ ++ E+E+  LQK+++  E+++D+  E+L  A  +
Sbjct  11   LKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKYSEALKDAQEK 70
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L   +K  ++AEGEVAALNRRIQL+EE+L+R++ RL TA  KL EA + ADESER  KV+
Sbjct  71   LELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQADESERGMKVI 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            ENR++ DEE+M+  E QLKEA+ +AE++DRKYDEVARKL ++E +LERAEERAE  E K 
Sbjct  131  ENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAEERAEVSELKS 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
             +LEEEL+ V N LKSLE   EK + +E+ Y+E+I  L  KLK AE RAEFAE++V KL+
Sbjct  191  GDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAEFAEKTVSKLE 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272
            K +D LEDEL N+K K K+I +ELD  +++++
Sbjct  251  KTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 61.8 bits 243,  Expect = 8e-11
 Identities = 63/251 25%, Positives = 130/251 51%, Gaps = 8/251 3%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L + +  
Sbjct  132  VKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEA 191
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
             +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E   + L
Sbjct  192  RLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEEQLEAL 245
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
             N+  S E++   L+++++      E+A R   ++ +++A +E      + + E     +
Sbjct  246  LNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLM 305
Query  181  VELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
             + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R +++ 
Sbjct  306  EQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHRRIHEQ 364
Query  240  QKEVDRLEDELVNEKEKYK 258
            + E+ RLE+E       YK
Sbjct  365  EIEIKRLENERDELSAAYK 383

Sequence Alignment: 43. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 54.7 bits 212,  Expect = 1e-08
 Identities = 57/249 22%, Positives = 123/249 49%, Gaps = 10/249 4%
Query  2    KLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQL 61
            K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+ ++  L + +   
Sbjct  219  KISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEAR 278
Query  62   VEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            +E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +        L
Sbjct  279  LELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSAL 338
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
            E +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E      S +
Sbjct  339  EKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV----SML 390
Query  181  VE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
            +E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A R +++ 
Sbjct  391  LEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQ 450
Query  240  QKEVDRLEDELVNEKEKYK 258
            + E+ RLE+E       YK
Sbjct  451  EIEIKRLENEREELAAAYK 469

Sequence Alignment: 44. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 52.9 bits 204,  Expect = 5e-08
 Identities = 80/257 31%, Positives = 135/257 52%, Gaps = 41/257 15%
Query  5    KDNAMDRADT-LEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESL--LKANNQL 61
            K++++++A T L  + KE     E ++  V++L KR +QLEN+   +Q  +  L   N  
Sbjct  330  KNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENENAGLQRRIEELTGENNT 389
Query  62   VEKDKAL----------SNAE--GEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQA 109
            +  +KAL          SNAE       L R  + L + L  +   L  A  +LA+  Q 
Sbjct  390  LRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQL 449
Query  110  ADESERMRKVLE------NRSLSDEE----RMDALENQLK---EARFLAEEADRKYDEVA 156
              + E  R  L         +L D E       A  NQLK   E R+   E D + + V 
Sbjct  450  RSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRL--REKDEEIENVR 507
Query  157  RKLAMVEADLERAEERAETG-ESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQI 215
            R  A    +L+R     ET  +++I  +++++    ++++ LE + + AN+    Y +QI
Sbjct  508  RSSARAIEELQRTLVEVETRYKTEISRMKKKFE---SDIRELEAALDNANRANSEYLKQI 564
Query  216  KTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 273
            K+L  ++K  E   E  ER V       D L ++L   + K  ++  EL+   + L G
Sbjct  565  KSLQQRVKELETLLE-EERRVS------DDLRNQLGVAERKRVALAQELEDARALLEG 615

Sequence Alignment: 45. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 50.2 bits 192,  Expect = 3e-07
 Identities = 61/251 24%, Positives = 129/251 51%, Gaps = 8/251 3%
Query  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
            +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L   +  
Sbjct  218  VKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEA 277
Query  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
             +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E   + L
Sbjct  278  RLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEEQLEAL 331
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
             N+  S E++   L+++++      E+A     ++ +++A +E      +++ E     +
Sbjct  332  LNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEEVTMLM 391
Query  181  VELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
             + ++ELR+    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R +++ 
Sbjct  392  EQAQKELRIKIGELQKLQHEYEKVRDQRDQLAREN-KKLTDDLAEAKSQLNDAHRRIHEQ 450
Query  240  QKEVDRLEDELVNEKEKYK 258
            + E+ RLE+E       YK
Sbjct  451  EIEIKRLENERDELSAAYK 469

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 49.0 bits 187,  Expect = 7e-07
 Identities = 69/260 26%, Positives = 125/260 48%, Gaps = 14/260 5%
Query  3    LEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQLV 62
            L  +   D    + Q+  E   + E   ++V  L+K   +L+++++ +   L KA N + 
Sbjct  307  LHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTIA 366
Query  63   EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL-- 120
              ++A    E +V  +  RI  L  +LE ++     A  +L +  Q  +++   ++ L  
Sbjct  367  ILERAKEQLEKQVLEMKSRIDELLVELEAAQREARAALAELQKMKQLYEKAVEQKEALAR 426
Query  121  ENRSLSDE--ERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGES 178
            EN+ L D+  E  +AL +  ++   L  E  R   E+ R L +   + E A   AE    
Sbjct  427  ENKKLQDDLHEANEALADANRKLHELDLENARLAGEI-RDLQVALKESEAARRDAEARAQ 485
Query  179  KIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEAR--AEFAERSV 236
            + +   +++R+     + L+  EE+     ++ + +I  LT  L  AEAR  AE A R  
Sbjct  486  RALAELQQVRI--EMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKAEIA-RLR 542
Query  237  QKLQKEVDRLE---DELVNEK-EKYKSITDELDQ 266
            +K Q E+  LE   D L     E  K+I  + +Q
Sbjct  543  KKYQAEIAELEMTVDNLNRANLEAQKTIKKQSEQ 576

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.