The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV
SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM
SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ
SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS
RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD
ALVFVDNHDNQRGGGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGPPQD
SDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCRG
DRGFVAFNVEDNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVRLIS
DDDGVLAIHLEEKL
Sequence Info Allergen Name Length Opt Bits Score E Value
AKH04310 Per a 11.0101 494 3440 790.4 0
Q2L7A6 Bla g 11.0101 515 2397 552.6 1.8e-158
AAD38942 Der p 4 496 438 106.1 4.6e-24
AAD38943 Eur m 4.0101 521 425 103.1 3.8e-23
AHX03180 Der f 4.0101 525 416 101.1 1.6e-22
AAQ24543 Blo t 4.0101 506 401 97.7 1.6e-21
AAA32708 Asp o 21 499 226 57.8 1.6e-09
BAA00336 Asp o 21 499 211 54.4 1.7e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 11.0101 Sequence ID: AKH04310

 Score = 790.4 bits 3440,  Expect = 0
 Identities = 494/494 100%, Positives = 494/494 100%, Gaps = 0/494 0%
Query  1    MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV 60
            MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV
Sbjct  1    MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV 60
Query  61   SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM 120
            SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM
Sbjct  61   SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM 120
Query  121  SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ 180
            SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ
Sbjct  121  SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ 180
Query  181  SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS 240
            SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS
Sbjct  181  SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS 240
Query  241  RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD 300
            RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD
Sbjct  241  RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD 300
Query  301  ALVFVDNHDNQRGGGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGPPQD 360
            ALVFVDNHDNQRGGGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGPPQD
Sbjct  301  ALVFVDNHDNQRGGGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGPPQD 360
Query  361  SDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCRG 420
            SDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCRG
Sbjct  361  SDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCRG 420
Query  421  DRGFVAFNVEDNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVRLIS 480
            DRGFVAFNVEDNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVRLIS
Sbjct  421  DRGFVAFNVEDNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVRLIS 480
Query  481  DDDGVLAIHLEEKL 494
            DDDGVLAIHLEEKL
Sbjct  481  DDDGVLAIHLEEKL 494

Sequence Alignment: 2. Allergen Name: Bla g 11.0101 Sequence ID: Q2L7A6

 Score = 552.6 bits 2397,  Expect = 2e-158
 Identities = 343/494 69%, Positives = 397/494 80%, Gaps = 4/494 0%
Query  1    MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV 60
            MKLF L+AL+VL+ GV SQKDP +    S ++ LFEWKF DIADECERFL PKG+AGVQV
Sbjct  1    MKLFPLVALLVLVVGVLSQKDPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQV 60
Query  61   SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM 120
            SPVH+N++ ++     WERYQ +SYKLVSRSGDE AFRDMVRRCN VG+RIYVDVVLN+M
Sbjct  61   SPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQM 120
Query  121  SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ 180
            SG+W +A G GGSTADTYN  YP VPY   DFH  C +++YQDP  VRNCELVGLHDL+Q
Sbjct  121  SGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHSTCTVSNYQDPSNVRNCELVGLHDLNQ 180
Query  181  SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS 240
              DYVR K+I++LNHLVD GVAGFRVDAAKHMWPADL+YIY KVNN N+D G+   + P 
Sbjct  181  GSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPF 240
Query  241  RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD 300
             YQEVIDLGGEA+   EY GFGRVTEFK+S  IG AFRGNN ++W   +   WG +P GD
Sbjct  241  FYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGD 300
Query  301  ALVFVDNHDNQRG---GGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGP 357
            ALVFVDNHDNQRG   GG +ILTYKT K YKMA+AF+LA+PYGYPRVMSSF F+  DQGP
Sbjct  301  ALVFVDNHDNQRGHGAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSFDNSDQGP 360
Query  358  PQDSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGF 417
            PQD + NI+SPSINADGTCGNGWVCEHRWRQ  NMVGFRNAV GT ++NWWDNG+ QI F
Sbjct  361  PQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISF 420
Query  418  CRGDRGFVAFNVE-DNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSV 476
            CRG++GFVAFN E +NDLKQTLQTCLPAG YCDVISGS  N +  G  + V  +G+A+  
Sbjct  421  CRGNKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIE 480
Query  477  RLISDDDGVLAIHLEEKL 494
             L S DDGVLAIH+  K+
Sbjct  481  ILSSADDGVLAIHVNSKV 498

Sequence Alignment: 3. Allergen Name: Der p 4 Sequence ID: AAD38942

 Score = 106.1 bits 438,  Expect = 5e-24
 Identities = 232/466 49%, Positives = 312/466 66%, Gaps = 33/466 7%
Query  21   DPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQVSPVHKNLLYTATAPGLW-ER 79
            +P ++ + S +  L EWK+DDI DECERFL P GY GVQVSPV+++ +     P  W ER
Sbjct  4    NPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILD-RRP--WYER 60
Query  80   YQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHMSGNWDNAVGTGGSTADTYN 139
            YQP+SY + +RSGDE  FR MV+RCN  GVRIYVD+VLNHM+G   +  GT G   D   
Sbjct  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGA-QSGKGTNGHHYDGNT 119
Query  140  YSYPGVPYDHSDFHPY--CI-----LNDYQDPEIVRNCELVGLHDLDQSQDYVREKLIDF 192
              YPGVP+  +DFH +  C      ++DY +P+  RNC L GL DL Q  +YVR+K +DF
Sbjct  120  LQYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDF 179
Query  193  LNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPSRYQEVIDLGGEA 252
            LNHL+D GVAGFR DA+ H WP DL  IY +++N N +  +  +S P  Y+E I  GG  
Sbjct  180  LNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEF-FPENSQPFIYHETIYYGGNG 238
Query  253  VSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGDALVFVDNHDNQR 312
            ++  EY  +GR+ EF+  ++I   FRGNN L W   +   WGL+PSGDALV +D+HD  R
Sbjct  239  INSNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHD-LR 297
Query  313  GGGNAILTYKTP----KNYKMAIAFILAHPYGYPRVMSSFDF--------EAHDQ-GPPQ 359
             G    L +       +  K A AF+LA  YG PRVMSS+ +        + +D  GPP 
Sbjct  298  VGHTGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPS 357
Query  360  DSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTE-ITNWWDNGNHQIGFC 418
            D + NILS   N D TC + W+CEHRWR+  NMV FR  + G E + NWWDNG++QI F 
Sbjct  358  DKNGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFR-MIAGQEPVHNWWDNGDYQIAFS 416
Query  419  RGDRGFVAFNVEDN--DLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSV 476
            RG+R F+A N++ N  +L+Q L+T LPAGTYCD+ISG+  +    G  + V  NG+A  V
Sbjct  417  RGNRAFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQA-DV 475
Query  477  RLISDD-DGVLAIHLEEKL 494
             +  D+ D  +A H+  ++
Sbjct  476  YVGHDEFDAFVAYHIGARI 494

Sequence Alignment: 4. Allergen Name: Eur m 4.0101 Sequence ID: AAD38943

 Score = 103.1 bits 425,  Expect = 4e-23
 Identities = 231/486 47%, Positives = 315/486 64%, Gaps = 36/486 7%
Query  1    MKLFALLALVVLLAG-VQSQ-KDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGV 58
            +KL  +L + +++   V+ +  +P ++ +   +  L EWK+DDI DECERFL P GY GV
Sbjct  7    LKLITVLFISLFVQNNVHCKYHNPHFIGNRCVITHLMEWKYDDIGDECERFLGPYGYGGV 66
Query  59   QVSPVHKNLLYTATAPGLW-ERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVL 117
            QVSPV+++ +     P  W ERYQP+SY L +RSGDE  FR MV+RCN  GVRIYVD+VL
Sbjct  67   QVSPVNEHAILDRR-P--WYERYQPVSYDLRTRSGDEQQFRRMVKRCNKAGVRIYVDIVL 123
Query  118  NHMSGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPY--CILND-----YQDPEIVRNC 170
            NHM+G   +  GT G+  +     YPGVP+  +DFH +  C   D     Y D    RNC
Sbjct  124  NHMTGG-QSGQGTNGNHYNGITMQYPGVPFGPNDFHGHESCQTKDLEIHNYSDRNEARNC 182
Query  171  ELVGLHDLDQSQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSD 230
             L GL DL Q  +YVR+K +DFLNHL+D GVAGFR DA+ H WP DL  IY +++  N +
Sbjct  183  RLSGLRDLKQQSEYVRKKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSQLHTLNKE 242
Query  231  AGYCGDSSPSRYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYK 290
              +  +S P  Y+E I  GG  ++  EY  +GR+ EF+  ++I   FRGNN+L W   + 
Sbjct  243  F-FPENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRGNNQLRWLKNFG 301
Query  291  PNWGLLPSGDALVFVDNHDNQRGGGNAILTYKT----PKNYKMAIAFILAHPYGYPRVMS 346
              WGL+PS DALV +D+HD  R G    L +       +  K + AF+LA  YG PRVMS
Sbjct  302  TEWGLVPSNDALVMIDSHD-LRVGHTGKLGFNINCFEARLLKASTAFMLAWNYGIPRVMS 360
Query  347  SFDF--------EAHDQ-GPPQDSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRN 397
            S+ +        + +D  GPP D   NILS   NAD TC + W+CEHRWRQ  NMV F+ 
Sbjct  361  SYFWNQIIRDGKDVNDWVGPPTDQHGNILSVHPNADLTCNHEWICEHRWRQIYNMVRFK- 419
Query  398  AVRGTE-ITNWWDNGNHQIGFCRGDRGFVAFNVE---DNDLKQTLQTCLPAGTYCDVISG 453
             + G E + NWWDNG++QI F RG   F+A N++   D +L+Q L+T LPAGTYCD+ISG
Sbjct  420  MIAGQEPVRNWWDNGDYQIAFSRGSHAFIAINLQKNGDKNLRQRLHTGLPAGTYCDIISG 479
Query  454  SKNNRAHLGAELVVAPNGEAFSVRLISDD-DGVLAIHLEEKL 494
               +    G  + V  NG A  + +  D+ D  +A H+  ++
Sbjct  480  DLIHNKCTGKSIQVDKNGLA-DIYVGHDELDAFVAYHIGARI 520

Sequence Alignment: 5. Allergen Name: Der f 4.0101 Sequence ID: AHX03180

 Score = 101.1 bits 416,  Expect = 2e-22
 Identities = 233/484 48%, Positives = 318/484 65%, Gaps = 39/484 8%
Query  3    LFALLALVVLL--AGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV 60
            L  +L L+V L   G     +P ++ + S +  L EWK+DDI DECERFL P GY GVQV
Sbjct  9    LITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQV 68
Query  61   SPVHKNLLYTATAPGLW-ERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNH 119
            SPV+++ +     P  W ERYQP+SY + +RSGDE  FR MV+RCN  GVRIYVD+VLNH
Sbjct  69   SPVNEHAIMDGR-P--WYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVLNH 125
Query  120  MSGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPY--CILND-----YQDPEIVRNCEL 172
            M+G   + +GT G   D     YPGVP+  +DFH +  C  ND     Y +    RNC L
Sbjct  126  MTGG-QSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNCRL 184
Query  173  VGLHDLDQSQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAG 232
            VGL DL Q  +YV++K +DFLNHL+D GVAGFR DA+ H WP DL  IY +++N N++  
Sbjct  185  VGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNEF- 243
Query  233  YCGDSSPSRYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPN 292
            +  +S P  Y+E I  GG  ++  EY  +GR+ EF+  ++I   FR NN+L W   +   
Sbjct  244  FTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFGTE 303
Query  293  WGLLPSGDALVFVDNHDNQRGGGNAILTYKT----PKNYKMAIAFILAHPYGYPRVMSSF 348
            WGL+PSGDALV +D+HD  R G    L +       +  K A AF+LA  YG PRVMSS+
Sbjct  304  WGLVPSGDALVMIDSHD-LRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMSSY 362
Query  349  DFE--------AHDQ-GPPQDSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAV 399
             ++         +D  GPP D   NILS   N D TC + W+CEHRWR+  NMV F+  +
Sbjct  363  FWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFK-LI 421
Query  400  RGTE-ITNWWDNGNHQIGFCRGDRGFVAFNVE------DNDLKQTLQTCLPAGTYCDVIS 452
             G E + NWWDNG++QI F RG+R F+A N++      D +L++ LQT LP G YCD+IS
Sbjct  422  AGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDIIS 481
Query  453  GSKNNRAHLGAELVVAPNGEAFSVRLISDD-DGVLAIHLEEKL 494
            G+  N   +G  + V  NG +  + +  D+ D  +A H++ ++
Sbjct  482  GNLINNRCMGKSIQVDKNGLS-DIYVGHDEFDAFVAYHIDARV 523

Sequence Alignment: 6. Allergen Name: Blo t 4.0101 Sequence ID: AAQ24543

 Score = 97.7 bits 401,  Expect = 2e-21
 Identities = 227/471 48%, Positives = 309/471 65%, Gaps = 29/471 6%
Query  7    LALVVLLAGVQSQ--KDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQVSPVH 64
            LAL +    + S    DP +  +   +  L +WKF DIADECERFL P GY GVQVSPV+
Sbjct  10   LALTIPYQTLASSPYSDPHFQHNRKVITHLMQWKFVDIADECERFLGPYGYGGVQVSPVN 69
Query  65   KNLLYTATAPGLW-ERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHMSGN 123
            +   + +     W E YQP+SY++VSRSG E+ FRDMV RCN  GVRIYVDVVLNHM+G 
Sbjct  70   E---HASLDRHPWYELYQPVSYRIVSRSGTESQFRDMVHRCNKAGVRIYVDVVLNHMTGP 126
Query  124  WDNAVGTGGSTADTYNYSYPGVPYDHSDFHPY--CI-----LNDYQDPEIVRNCELVGLH 176
              + VG  G+  D  +  YPG+P+  +DFH +  C      + +Y DP   RNC L GL 
Sbjct  127  -QSGVGIDGTHYDGNSMQYPGIPFGPNDFHGHESCPTSNLDIQNYDDPTQARNCRLSGLR 185
Query  177  DLDQSQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGD 236
            DL QS DYVR K  DFLNHL+D GVAGFR DA+KHMWP DL+ IY K+++ N +  +  +
Sbjct  186  DLKQSADYVRTKQADFLNHLIDIGVAGFRFDASKHMWPGDLQAIYSKLHHLN-EKYFPSN 244
Query  237  SSPSRYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLL 296
            S+P  Y+EVI     A+S  +Y  +GR  EF +  ++    RGNN+L+W + +   WG++
Sbjct  245  SNPFIYHEVIYSNNNAISISDYTKLGRSIEFHYYHELCNVIRGNNKLKWLHNFGQPWGMV 304
Query  297  PSGDALVFVDNHDNQRGGGNAI---LTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFE-- 351
            P+ DAL+ VD+HD QRG    +   + Y   +  K+A AF+LA PYG PRVMSS+ +   
Sbjct  305  PNDDALIMVDSHDLQRGHTGQLGLNINYFESRLLKVATAFMLAWPYGIPRVMSSYRWNQK 364
Query  352  ---AHDQ----GPPQDSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEI 404
                 D+    GPP D   +ILS   N+D TC   W+CEHRW+Q  NMV FRN      +
Sbjct  365  IVNGKDENDWIGPPADGSGSILSVKPNSDLTCNQEWICEHRWKQIYNMVQFRNTAGDEPV 424
Query  405  TNWWDNGNHQIGFCRGDRGFVAFNVEDND-LKQTLQTCLPAGTYCDVISGSKNNRAHLGA 463
             NWWDNG++QI F RG + F+A N+++   LKQ L+T LP+G YC++++G+ +N    G 
Sbjct  425  KNWWDNGDYQIAFSRGAKTFIAINLQNGQHLKQNLHTGLPSGNYCNLVTGNVHNGKCSGQ 484
Query  464  ELVVAPNGEAF-SVRLISDD 482
             + V  +G A  S+   +DD
Sbjct  485  MVHVDGSGHAMISIGANADD 504

Sequence Alignment: 7. Allergen Name: Asp o 21 Sequence ID: AAA32708

 Score = 57.8 bits 226,  Expect = 2e-09
 Identities = 105/343 30%, Positives = 166/343 48%, Gaps = 58/343 16%
Query  37   WKFDDIADECERFLAPKGYAGVQVSPVHKNLLYTATAPGLWERY-QPMSYKLVSRSGDET 95
            W+   I D+ + ++   G+  + ++PV   L  T      +  Y Q   Y L    G   
Sbjct  63   WQ--GIIDKLD-YIQGMGFTAIWITPVTAQLPQTTAYGDAYHGYWQQDIYSLNENYGTAD 119
Query  96   AFRDMVRRCNAVGVRIYVDVVLNHMSGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPY 155
             ++ +    +  G+ + VDVV NHM   +D A    GS+ D Y+   P    D+  FHP+
Sbjct  120  DLKALSSALHERGMYLMVDVVANHM--GYDGA----GSSVD-YSVFKPFSSQDY--FHPF 170
Query  156  CILNDYQDPEIVRNCEL----VGLHDLDQSQDYVREKLIDFLNHLV-DAGVAGFRVDAAK 210
            C++ +Y+D   V +C L    V L DLD ++D V+ +  D++  LV +  + G+R+D  K
Sbjct  171  CLIQNYEDQTQVEDCWLGDNTVSLPDLDTTKDVVKNEWYDWVGSLVSNYSIDGLRIDTVK 230
Query  211  HM----WP----ADLEYIYGKVNNRNSDAGYCGDSSPSRYQEVIDLGGEAVSKFEYNGFG 262
            H+    WP    A   Y  G+V   + D  Y   + P  YQ V+D     V  +    + 
Sbjct  231  HVQKDFWPGYNKAAGVYCIGEV--LDGDPAY---TCP--YQNVMD----GVLNYPIY-YP 278
Query  263  RVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGDALVFVDNHDNQRGGG--NAILT 320
             +  FK +   G      N +    +  P+  LL +     FV+NHDN R     N I  
Sbjct  279  LLNAFKSTS--GSMHDLYNMINTVKSDCPDSTLLGT-----FVENHDNPRFASYTNDIAL 331
Query  321  YKTPKNYKM---AIAFILA-HPYGYPRVMSSFDFEAH-DQGPPQDSDKNILSPSINA--- 372
             K    + +    I  I A +   Y       + EA    G P DS+   L  S NA   
Sbjct  332  AKNVAAFIILNDGIPIIYAGQEQHYAGGNDPANREATWASGYPTDSELYKLIASANAIRN 391
Query  373  -DGTCGNGWVCEHRW--RQHANMVGFRNAVRGTEITNWWDN 410
               +   G+V    W   +    +  R    G++I     N
Sbjct  392  YAISKDTGFVTYKNWPIYKDDTTIAMRKGTDGSQIVTILSN 432

Sequence Alignment: 8. Allergen Name: Asp o 21 Sequence ID: BAA00336

 Score = 54.4 bits 211,  Expect = 2e-08
 Identities = 105/343 30%, Positives = 164/343 47%, Gaps = 58/343 16%
Query  37   WKFDDIADECERFLAPKGYAGVQVSPVHKNLLYTATAPGLWERY-QPMSYKLVSRSGDET 95
            W+   I D+ + ++   G+  + ++PV   L  T      +  Y Q   Y L    G   
Sbjct  63   WQ--GIIDKLD-YIQGMGFTAIWITPVTAQLPQTTAYGDAYHGYWQQDIYSLNENYGTAD 119
Query  96   AFRDMVRRCNAVGVRIYVDVVLNHMSGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPY 155
             ++ +    +  G+ + VDVV NHM   +D A    GS+ D Y+   P    D+  FHP+
Sbjct  120  DLKALSSALHERGMYLMVDVVANHM--GYDGA----GSSVD-YSVFKPFSSQDY--FHPF 170
Query  156  CILNDYQDPEIVRNCEL----VGLHDLDQSQDYVREKLIDFLNHLV-DAGVAGFRVDAAK 210
            C + +Y+D   V  C L    V L DLD ++D V+ +  D++  LV +  + G+R+D  K
Sbjct  171  CFIQNYEDQTQVEYCWLGDNTVSLLDLDTTKDVVKNEWYDWVGSLVSNYSIDGLRIDTVK 230
Query  211  HM----WP----ADLEYIYGKVNNRNSDAGYCGDSSPSRYQEVIDLGGEAVSKFEYNGFG 262
            H+    WP    A   Y  G+V   + D  Y   + P  YQ V+D     V  +    + 
Sbjct  231  HVQKDFWPGYNKAAGVYCIGEV--LDVDPAY---TCP--YQNVMD----GVLNYPIY-YP 278
Query  263  RVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGDALVFVDNHDNQRGGG--NAILT 320
             +  FK +   G      N +    +  P+  LL +     FV+NHDN R     N I  
Sbjct  279  LLNAFKSTS--GSMDDLYNMINTVKSDCPDSTLLGT-----FVENHDNPRFASYTNDIAL 331
Query  321  YKTPKNYKM---AIAFILA-HPYGYPRVMSSFDFEAH-DQGPPQDSDKNILSPSINA--- 372
             K    + +    I  I A +   Y       + EA    G P DS+   L  S NA   
Sbjct  332  AKNVAAFIILNDGIPIIYAGQEQHYAGGNDPANREATWLSGYPTDSELYKLIASANAIRN 391
Query  373  -DGTCGNGWVCEHRW--RQHANMVGFRNAVRGTEITNWWDN 410
               +   G+V    W   +    +  R    G++I     N
Sbjct  392  YAISKDTGFVTYKNWPIYKDDTTIAMRKGTDGSQIVTILSN 432

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.