The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLFPLVALLVLVVGVLSQKDPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQV
SPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQM
SGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHSTCTVSNYQDPSNVRNCELVGLHDLNQ
GSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPF
FYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGD
ALVFVDNHDNQRGHGAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSFDNSDQGP
PQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISF
CRGNKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIE
ILSSADDGVLAIHVNSKVGSKSQTTTTQSSHCTCS
Sequence Info Allergen Name Length Opt Bits Score E Value
Q2L7A6 Bla g 11.0101 515 3603 827.5 0
AKH04310 Per a 11.0101 494 2397 552.6 1.8e-158
AAD38942 Der p 4 496 1276 297.1 1.5e-81
AHX03180 Der f 4.0101 525 1263 294.1 1.3e-80
AAD38943 Eur m 4.0101 521 1250 291.2 9.8e-80
AAQ24543 Blo t 4.0101 506 772 182.2 5.9e-47
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 11.0101 Sequence ID: Q2L7A6

 Score = 827.5 bits 3603,  Expect = 0
 Identities = 515/515 100%, Positives = 515/515 100%, Gaps = 0/515 0%
Query  1    MKLFPLVALLVLVVGVLSQKDPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQV 60
            MKLFPLVALLVLVVGVLSQKDPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQV
Sbjct  1    MKLFPLVALLVLVVGVLSQKDPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQV 60
Query  61   SPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQM 120
            SPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQM
Sbjct  61   SPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQM 120
Query  121  SGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHSTCTVSNYQDPSNVRNCELVGLHDLNQ 180
            SGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHSTCTVSNYQDPSNVRNCELVGLHDLNQ
Sbjct  121  SGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHSTCTVSNYQDPSNVRNCELVGLHDLNQ 180
Query  181  GSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPF 240
            GSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPF
Sbjct  181  GSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPF 240
Query  241  FYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGD 300
            FYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGD
Sbjct  241  FYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGD 300
Query  301  ALVFVDNHDNQRGHGAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSFDNSDQGP 360
            ALVFVDNHDNQRGHGAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSFDNSDQGP
Sbjct  301  ALVFVDNHDNQRGHGAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSFDNSDQGP 360
Query  361  PQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISF 420
            PQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISF
Sbjct  361  PQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISF 420
Query  421  CRGNKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIE 480
            CRGNKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIE
Sbjct  421  CRGNKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIE 480
Query  481  ILSSADDGVLAIHVNSKVGSKSQTTTTQSSHCTCS 515
            ILSSADDGVLAIHVNSKVGSKSQTTTTQSSHCTCS
Sbjct  481  ILSSADDGVLAIHVNSKVGSKSQTTTTQSSHCTCS 515

Sequence Alignment: 2. Allergen Name: Per a 11.0101 Sequence ID: AKH04310

 Score = 552.6 bits 2397,  Expect = 2e-158
 Identities = 343/494 69%, Positives = 397/494 80%, Gaps = 4/494 0%
Query  1    MKLFPLVALLVLVVGVLSQKDPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQV 60
            MKLF L+AL+VL+ GV SQKDP +    S ++ LFEWKF DIADECERFL PKG+AGVQV
Sbjct  1    MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV 60
Query  61   SPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQM 120
            SPVH+N++ ++     WERYQ +SYKLVSRSGDE AFRDMVRRCN VG+RIYVDVVLN+M
Sbjct  61   SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM 120
Query  121  SGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHSTCTVSNYQDPSNVRNCELVGLHDLNQ 180
            SG+W +A G GGSTADTYN  YP VPY   DFH  C +++YQDP  VRNCELVGLHDL+Q
Sbjct  121  SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ 180
Query  181  GSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPF 240
              DYVR K+I++LNHLVD GVAGFRVDAAKHMWPADL+YIY KVNN N+D G+   + P 
Sbjct  181  SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS 240
Query  241  FYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGD 300
             YQEVIDLGGEA+   EY GFGRVTEFK+S  IG AFRGNN ++W   +   WG +P GD
Sbjct  241  RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD 300
Query  301  ALVFVDNHDNQRGHGAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSFDNSDQGP 360
            ALVFVDNHDNQRG   GG +ILTYKT K YKMA+AF+LA+PYGYPRVMSSF F+  DQGP
Sbjct  301  ALVFVDNHDNQRG---GGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGP 357
Query  361  PQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISF 420
            PQD + NI+SPSINADGTCGNGWVCEHRWRQ  NMVGFRNAV GT ++NWWDNG+ QI F
Sbjct  358  PQDSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGF 417
Query  421  CRGNKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIE 480
            CRG++GFVAFN E +NDLKQTLQTCLPAG YCDVISGS  N +  G  + V  +G+A+  
Sbjct  418  CRGDRGFVAFNVE-DNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSV 476
Query  481  ILSSADDGVLAIHVNSKV 498
             L S DDGVLAIH+  K+
Sbjct  477  RLISDDDGVLAIHLEEKL 494

Sequence Alignment: 3. Allergen Name: Der p 4 Sequence ID: AAD38942

 Score = 297.1 bits 1276,  Expect = 2e-81
 Identities = 251/475 52%, Positives = 331/475 69%, Gaps = 23/475 4%
Query  21   DPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQVSPVHENVIISSPFRPWWERY 80
            +PH    RS I HL EWK+ DI DECERFLGP G+ GVQVSPV+E+ I+    RPW+ERY
Sbjct  4    NPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDR--RPWYERY 61
Query  81   QLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQMSGSWPDAHGQGGSTADTYNL 140
            Q VSY + +RSGDE  FR MV+RCN  G+RIYVD+VLN+M+G+     G  G   D   L
Sbjct  62   QPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQ-SGKGTNGHHYDGNTL 120
Query  141  QYPAVPYGPGDFHS--TCT-----VSNYQDPSNVRNCELVGLHDLNQGSDYVRGKMIEYL 193
            QYP VP+GP DFH   +C      + +Y +P   RNC L GL DL Q S+YVR K +++L
Sbjct  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
Query  194  NHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPFFYQEVIDLGGEAI 253
            NHL+D GVAGFR DA+ H WP DL+ IYS+++NLN +  FP  ++PF Y+E I  GG  I
Sbjct  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEF-FPENSQPFIYHETIYYGGNGI 239
Query  254  HSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGDALVFVDNHDNQRG 313
            +S EYT +GR+ EF++ ++I + FRGNN + WL NFG  WG +P GDALV +D+HD + G
Sbjct  240  NSNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVG 299
Query  314  H-GAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSF-----DNSDQ----GPPQD 363
            H G  G +I  ++  +L K A AFMLA+ YG PRVMSS+ +     D  D     GPP D
Sbjct  300  HTGKLGFNINCFE-GRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSD 358
Query  364  GNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISFCRG 423
             NGNI+S   N D TC + W+CEHRWR+I+NMV FR       V NWWDNGD QI+F RG
Sbjct  359  KNGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRG 418
Query  424  NKGFVAFNDEFNN-DLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIEIL 482
            N+ F+A N + N  +L+Q L+T LPAG YCD+ISG+  +  CTGK++ V  +G+A + + 
Sbjct  419  NRAFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVG 478
Query  483  SSADDGVLAIHVNSKVGS 500
                D  +A H+ +++ S
Sbjct  479  HDEFDAFVAYHIGARIVS 496

Sequence Alignment: 4. Allergen Name: Der f 4.0101 Sequence ID: AHX03180

 Score = 294.1 bits 1263,  Expect = 1e-80
 Identities = 252/493 51%, Positives = 340/493 68%, Gaps = 32/493 6%
Query  3    LFPLVALLVLVVGVLSQKD-----PHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAG 57
            +F L+ +L L+V ++   D     PH    RS I HL EWK+ DI DECERFLGP G+ G
Sbjct  6    FFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGG 65
Query  58   VQVSPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVL 117
            VQVSPV+E+ I+    RPW+ERYQ VSY + +RSGDE  FR MV+RCN  G+RIYVD+VL
Sbjct  66   VQVSPVNEHAIMDG--RPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVL 123
Query  118  NQMSGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHS--TCT-----VSNYQDPSNVRNC 170
            N+M+G      G  G   D   +QYP VP+GP DFH   TC      + NY +    RNC
Sbjct  124  NHMTGGQ-SGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNC 182
Query  171  ELVGLHDLNQGSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTD 230
             LVGL DL Q S+YV+ K +++LNHL+D GVAGFR DA+ H WP DL+ IYS+++NLN +
Sbjct  183  RLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNE 242
Query  231  HGFPSGARPFFYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFG 290
              F   + PF Y+E I  GG  I+S EYT +GR+ EF++ ++I + FR NN ++WL NFG
Sbjct  243  F-FTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFG 301
Query  291  VGWGYIPDGDALVFVDNHDNQRGH-GAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMS 349
              WG +P GDALV +D+HD + GH G  G +I  ++ ++L K A AFMLA+ YG PRVMS
Sbjct  302  TEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFE-ARLLKAATAFMLAWNYGIPRVMS 360
Query  350  SFSFD---------NSDQGPPQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRN 400
            S+ +D         N   GPP D +GNI+S   N D TC + W+CEHRWR+I+NMV F+ 
Sbjct  361  SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL 420
Query  401  AVAGTAVSNWWDNGDKQISFCRGNKGFVAFN-----DEFNNDLKQTLQTCLPAGDYCDVI 455
                  V+NWWDNGD QI+F RGN+ F+A N     ++ + +L++ LQT LP G YCD+I
Sbjct  421  IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII 480
Query  456  SGSYENGSCTGKTVTVGSDGKAYIEILSSADDGVLAIHVNSKVGS 500
            SG+  N  C GK++ V  +G + I +     D  +A H++++V S
Sbjct  481  SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES 525

Sequence Alignment: 5. Allergen Name: Eur m 4.0101 Sequence ID: AAD38943

 Score = 291.2 bits 1250,  Expect = 1e-79
 Identities = 251/493 50%, Positives = 338/493 68%, Gaps = 26/493 5%
Query  1    MKLFPLVALLVLVVGVLSQK--DPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGV 58
            +KL  ++ + ++V   +  K  +PH    R  I HL EWK+ DI DECERFLGP G+ GV
Sbjct  7    LKLITVLFISLFVQNNVHCKYHNPHFIGNRCVITHLMEWKYDDIGDECERFLGPYGYGGV 66
Query  59   QVSPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLN 118
            QVSPV+E+ I+    RPW+ERYQ VSY L +RSGDE  FR MV+RCN  G+RIYVD+VLN
Sbjct  67   QVSPVNEHAILDR--RPWYERYQPVSYDLRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLN 124
Query  119  QMSGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHS--TCT-----VSNYQDPSNVRNCE 171
            +M+G     +G  G+  +   +QYP VP+GP DFH   +C      + NY D +  RNC 
Sbjct  125  HMTGGQ-SGQGTNGNHYNGITMQYPGVPFGPNDFHGHESCQTKDLEIHNYSDRNEARNCR 183
Query  172  LVGLHDLNQGSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDH 231
            L GL DL Q S+YVR K +++LNHL+D GVAGFR DA+ H WP DL+ IYS+++ LN + 
Sbjct  184  LSGLRDLKQQSEYVRKKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSQLHTLNKEF 243
Query  232  GFPSGARPFFYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGV 291
             FP  + PF Y+E I  GG  I+S EYT +GR+ EF++ ++I + FRGNN ++WL NFG 
Sbjct  244  -FPENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRGNNQLRWLKNFGT 302
Query  292  GWGYIPDGDALVFVDNHDNQRGH-GAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSS 350
             WG +P  DALV +D+HD + GH G  G +I  ++ ++L K + AFMLA+ YG PRVMSS
Sbjct  303  EWGLVPSNDALVMIDSHDLRVGHTGKLGFNINCFE-ARLLKASTAFMLAWNYGIPRVMSS 361
Query  351  FSF-----DNSDQ----GPPQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNA 401
            + +     D  D     GPP D +GNI+S   NAD TC + W+CEHRWRQI+NMV F+  
Sbjct  362  YFWNQIIRDGKDVNDWVGPPTDQHGNILSVHPNADLTCNHEWICEHRWRQIYNMVRFKMI 421
Query  402  VAGTAVSNWWDNGDKQISFCRGNKGFVAFNDEFNND--LKQTLQTCLPAGDYCDVISGSY 459
                 V NWWDNGD QI+F RG+  F+A N + N D  L+Q L+T LPAG YCD+ISG  
Sbjct  422  AGQEPVRNWWDNGDYQIAFSRGSHAFIAINLQKNGDKNLRQRLHTGLPAGTYCDIISGDL 481
Query  460  ENGSCTGKTVTVGSDGKAYIEILSSADDGVLAIHVNSKV 498
             +  CTGK++ V  +G A I +     D  +A H+ +++
Sbjct  482  IHNKCTGKSIQVDKNGLADIYVGHDELDAFVAYHIGARI 520

Sequence Alignment: 6. Allergen Name: Blo t 4.0101 Sequence ID: AAQ24543

 Score = 182.2 bits 772,  Expect = 6e-47
 Identities = 258/462 55%, Positives = 327/462 70%, Gaps = 22/462 4%
Query  21   DPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQVSPVHENVIISSPFRPWWERY 80
            DPH    R  I HL +WKF DIADECERFLGP G+ GVQVSPV+E+   S    PW+E Y
Sbjct  26   DPHFQHNRKVITHLMQWKFVDIADECERFLGPYGYGGVQVSPVNEHA--SLDRHPWYELY 83
Query  81   QLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQMSGSWPDAHGQGGSTADTYNL 140
            Q VSY++VSRSG E+ FRDMV RCN  G+RIYVDVVLN+M+G      G  G+  D  ++
Sbjct  84   QPVSYRIVSRSGTESQFRDMVHRCNKAGVRIYVDVVLNHMTGPQSGV-GIDGTHYDGNSM 142
Query  141  QYPAVPYGPGDFHS--TCTVSN-----YQDPSNVRNCELVGLHDLNQGSDYVRGKMIEYL 193
            QYP +P+GP DFH   +C  SN     Y DP+  RNC L GL DL Q +DYVR K  ++L
Sbjct  143  QYPGIPFGPNDFHGHESCPTSNLDIQNYDDPTQARNCRLSGLRDLKQSADYVRTKQADFL 202
Query  194  NHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPFFYQEVIDLGGEAI 253
            NHL+D GVAGFR DA+KHMWP DLQ IYSK+++LN  + FPS + PF Y+EVI     AI
Sbjct  203  NHLIDIGVAGFRFDASKHMWPGDLQAIYSKLHHLNEKY-FPSNSNPFIYHEVIYSNNNAI 261
Query  254  HSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGDALVFVDNHDNQRG 313
              ++YT +GR  EF Y  ++ +  RGNN +KWL NFG  WG +P+ DAL+ VD+HD QRG
Sbjct  262  SISDYTKLGRSIEFHYYHELCNVIRGNNKLKWLHNFGQPWGMVPNDDALIMVDSHDLQRG 321
Query  314  H-GAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSF--------DNSDQ-GPPQD 363
            H G  G +I  Y  S+L K+A AFMLA+PYG PRVMSS+ +        D +D  GPP D
Sbjct  322  HTGQLGLNI-NYFESRLLKVATAFMLAWPYGIPRVMSSYRWNQKIVNGKDENDWIGPPAD 380
Query  364  GNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISFCRG 423
            G+G+I+S   N+D TC   W+CEHRW+QI+NMV FRN      V NWWDNGD QI+F RG
Sbjct  381  GSGSILSVKPNSDLTCNQEWICEHRWKQIYNMVQFRNTAGDEPVKNWWDNGDYQIAFSRG 440
Query  424  NKGFVAFNDEFNNDLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIEILS 483
             K F+A N +    LKQ L+T LP+G+YC++++G+  NG C+G+ V V   G A I I +
Sbjct  441  AKTFIAINLQNGQHLKQNLHTGLPSGNYCNLVTGNVHNGKCSGQMVHVDGSGHAMISIGA 500
Query  484  SADD 487
            +ADD
Sbjct  501  NADD 504

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.