The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC
VPSGTYGNKDECPCYRDLKNSKGNPKCP
Sequence Info Allergen Name Length Opt Bits Score E Value
XP_016648029 Pru m 7.0101 88 657 125.6 2e-31
XP_021820299 Pru av 7.01 88 643 123.1 1.1e-30
P86888 Pru p 7.0101 63 506 98.6 1.8e-23
C0HLQ1 Cry j 7.0101 63 365 73.6 6.4e-16
C0HLQ2 Cup s 7.0102 63 362 73.0 9.3e-16
C0HLQ0 Jun a 7.0101 63 357 72.2 1.7e-15
BBP47166 Cup s 7.0101 113 359 72.7 2.1e-15
C0HLL6 Cup s 7.01 32 177 39.9 4.5e-06
C0HKC0 Pun g 7.01 20 128 31.0 0.0013
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pru m 7.0101 Sequence ID: XP_016648029

 Score = 125.6 bits 657,  Expect = 2e-31
 Identities = 88/88 100%, Positives = 88/88 100%, Gaps = 0/88 0%
Query  1    MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC 60
            MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC
Sbjct  1    MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC 60
Query  61   VPSGTYGNKDECPCYRDLKNSKGNPKCP 88
            VPSGTYGNKDECPCYRDLKNSKGNPKCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGNPKCP 88

Sequence Alignment: 2. Allergen Name: Pru av 7.01 Sequence ID: XP_021820299

 Score = 123.1 bits 643,  Expect = 1e-30
 Identities = 86/88 97%, Positives = 88/88 100%, Gaps = 0/88 0%
Query  1    MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC 60
            MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGY+ERCLKYCGICCEKC+C
Sbjct  1    MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYKERCLKYCGICCEKCNC 60
Query  61   VPSGTYGNKDECPCYRDLKNSKGNPKCP 88
            VPSGTYGNKDECPCYRDLKNSKGNPKCP
Sbjct  61   VPSGTYGNKDECPCYRDLKNSKGNPKCP 88

Sequence Alignment: 3. Allergen Name: Pru p 7.0101 Sequence ID: P86888

 Score = 98.6 bits 506,  Expect = 2e-23
 Identities = 63/63 100%, Positives = 63/63 100%, Gaps = 0/63 0%
Query  26   GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNP 85
            GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNP
Sbjct  1    GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNP 60
Query  86   KCP 88
            KCP
Sbjct  61   KCP 63

Sequence Alignment: 4. Allergen Name: Cry j 7.0101 Sequence ID: C0HLQ1

 Score = 73.6 bits 365,  Expect = 6e-16
 Identities = 43/59 72%, Positives = 49/59 83%, Gaps = 0/59 0%
Query  30   CDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP 88
            CD +C  RCSKA  ++RCLKYCGICCEKC+CVP GTYGN+D CPCY +LKNSKG  KCP
Sbjct  5    CDKECNRRCSKASAHDRCLKYCGICCEKCNCVPPGTYGNEDSCPCYANLKNSKGGHKCP 63

Sequence Alignment: 5. Allergen Name: Cup s 7.0102 Sequence ID: C0HLQ2

 Score = 73.0 bits 362,  Expect = 9e-16
 Identities = 43/59 72%, Positives = 48/59 81%, Gaps = 0/59 0%
Query  30   CDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP 88
            CD +C  RCSKA  ++RCLKYCGICCEKCHCVP GT GN+D CPCY +LKNSKG  KCP
Sbjct  5    CDKECNRRCSKASAHDRCLKYCGICCEKCHCVPPGTAGNEDVCPCYANLKNSKGGHKCP 63

Sequence Alignment: 6. Allergen Name: Jun a 7.0101 Sequence ID: C0HLQ0

 Score = 72.2 bits 357,  Expect = 2e-15
 Identities = 42/59 71%, Positives = 48/59 81%, Gaps = 0/59 0%
Query  30   CDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP 88
            CD +C  RCSKA  ++RCLKYCGICC+KCHCVP GT GN+D CPCY +LKNSKG  KCP
Sbjct  5    CDKECNRRCSKASAHDRCLKYCGICCKKCHCVPPGTAGNEDVCPCYANLKNSKGGHKCP 63

Sequence Alignment: 7. Allergen Name: Cup s 7.0101 Sequence ID: BBP47166

 Score = 72.7 bits 359,  Expect = 2e-15
 Identities = 42/59 71%, Positives = 48/59 81%, Gaps = 0/59 0%
Query  30   CDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP 88
            CD +C  RCSKA  ++RC+KYCGICCEKCHCVP GT GN+D CPCY +LKNSKG  KCP
Sbjct  55   CDKECNRRCSKASAHDRCIKYCGICCEKCHCVPPGTAGNEDVCPCYANLKNSKGGHKCP 113

Sequence Alignment: 8. Allergen Name: Cup s 7.01 Sequence ID: C0HLL6

 Score = 39.9 bits 177,  Expect = 4e-06
 Identities = 23/28 82%, Positives = 24/28 85%, Gaps = 8/28 28%
Query  30   CDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGT 65
            CD +C  RCSKA        YCGICCEKCHCVP GT
Sbjct  5    CDKECNRRCSKA--------YCGICCEKCHCVPPGT 32

Sequence Alignment: 9. Allergen Name: Pun g 7.01 Sequence ID: C0HKC0

 Score = 31.0 bits 128,  Expect = 0.001
 Identities = 17/20 85%, Positives = 18/20 90%, Gaps = 0/20 0%
Query  26   GSSFCDSKCGVRCSKAGYQE 45
            GSSFCDSKC VRCSKAG Q+
Sbjct  1    GSSFCDSKCAVRCSKAGVQD 20

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.