The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE
SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF
QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARGE
K
Sequence Info Allergen Name Length Opt Bits Score E Value
S0BDX9 Cav p 6.0101 181 1214 283.7 2.1e-78
XP_855342 Can f 6.0101 190 645 154.0 2.5e-39
AAS77253 Fel d 4 186 639 152.6 6.2e-39
P02761 Rat n 1 181 598 143.3 3.9e-36
Q95182 Equ c 1 187 585 140.3 3.2e-35
P02762 Mus m 1 180 536 129.2 6.9e-32
AAA39768 Mus m 1.0102 180 534 128.7 9.5e-32
U6C8D6 Ory c 4.0101 172 510 123.3 4e-30
O18874 Can f 2 180 279 70.6 3e-14
Q9QXU1 Mes a 1.0101 172 247 63.3 4.4e-12
Q28133 Bos d 2.0101 172 236 60.8 2.5e-11
A59225 Bos d 2.0102 156 230 59.5 5.6e-11
B59225 Bos d 2.0103 156 216 56.3 5.1e-10
P02754 Bos d 5 178 213 55.5 1e-09
CAA32835 Bos d 5 178 197 51.9 1.2e-08
O18873 Can f 1 174 189 50.1 4.3e-08
ADK56160 Fel d 7.0101 180 187 49.6 6.2e-08
AAA30411 Bos d 5 151 184 49.0 7.7e-08
CAX62130 Cav p 3.0101 170 184 49.0 9.1e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 283.7 bits 1214,  Expect = 2e-78
 Identities = 181/181 100%, Positives = 181/181 100%, Gaps = 0/181 0%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE
Sbjct  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
Query  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF 120
            SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF
Sbjct  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF 120
Query  121  QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARGE 180
            QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARGE
Sbjct  121  QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARGE 180
Query  181  K 181
            K
Sbjct  181  K 181

Sequence Alignment: 2. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 154.0 bits 645,  Expect = 2e-39
 Identities = 98/178 55%, Positives = 131/178 73%, Gaps = 1/178 0%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            MKL LLCLGLIL+  + E ++VV+GNFD  KISG+WY++  ASD +E IEE GSMRVFV+
Sbjct  1    MKLLLLCLGLILVHAHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVK 60
Query  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVA-EGVYAVEYDGYNVFRVAETDYKNYAI 119
             IE + +S+L F      NG+C +ISLICN+   +G Y V +DGYN+FR+ ET Y++Y I
Sbjct  61   DIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYII 120
Query  120  FQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQAR 178
            F+L N   E  FQL+ELYGR+PDVS ++K +F  +C+   I + NI+D+T VDRCLQAR
Sbjct  121  FHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQAR 179

Sequence Alignment: 3. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 152.6 bits 639,  Expect = 6e-39
 Identities = 98/176 55%, Positives = 129/176 73%, Gaps = 3/176 1%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            MKL LLCLGLIL+C + E + VVR N D  KISG WY++  ASD +E IEE GSMRVFVE
Sbjct  1    MKLLLLCLGLILVCAH-EEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVE 59
Query  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF 120
             I+ + +S+LSF F   ENG+C +I L+ ++  +GVY V YDGYNVF + ET Y  Y ++
Sbjct  60   HIKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILL 119
Query  121  QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARG 179
            +L NF     FQL+E+Y REPDVS ++K +F  +C+++GI   NI+D+T VDRCLQARG
Sbjct  120  HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQARG 176

Sequence Alignment: 4. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 143.3 bits 598,  Expect = 4e-36
 Identities = 90/176 51%, Positives = 123/176 69%, Gaps = 2/176 1%
Query  3    LQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVESI 62
            L LLCLGL L+C + E     RGN+D  K++G+W+++  AS+KRE IEE GSMRVF++ I
Sbjct  5    LLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHI 64
Query  63   EPVKDSALSFKFWAHENGECKQISLICNRVAE-GVYAVEYDGYNVFRVAETDYKNYAIFQ 121
            + +++S L FKF   ENGEC+++ L+  +  E G Y VEYDG N F + +TDY  Y +F+
Sbjct  65   DVLENS-LGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFH 123
Query  122  LRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARG 179
            L NFK   +FQL+ LYGR  D+S +IK +F  +C  +GI   NIID+T  DRCLQARG
Sbjct  124  LINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG 181

Sequence Alignment: 5. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 140.3 bits 585,  Expect = 3e-35
 Identities = 92/178 51%, Positives = 123/178 69%, Gaps = 4/178 2%
Query  1    MKLQLLCLGLILLCTQGE--GDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVF 58
            MKL LLCLGLIL+C Q E   D  +R NFD  KISG WY++  ASD +E IEE GSMRVF
Sbjct  1    MKLLLLCLGLILVCAQQEENSDVAIR-NFDISKISGEWYSIFLASDVKEKIEENGSMRVF 59
Query  59   VESIEPVKDSALSFKFWAHENGECKQISLICNRVAE-GVYAVEYDGYNVFRVAETDYKNY 117
            V+ I  + +S+L  ++    NGEC +  ++ ++  E GVY++ YDGYNVFR++E +   +
Sbjct  60   VDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEH 119
Query  118  AIFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQA 177
             I+ L NF  +  FQL+E+Y REPDVS EIK  F    +K GI + NIID+T +DRC+Q 
Sbjct  120  IILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQL 179
Query  178  RG 179
            RG
Sbjct  180  RG 181

Sequence Alignment: 6. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 129.2 bits 536,  Expect = 7e-32
 Identities = 83/177 46%, Positives = 122/177 68%, Gaps = 3/177 1%
Query  1    MK-LQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFV 59
            MK L LLCLGL L+C + E       NF+ EKI+G W+T+  ASDKRE IE+ G+ R+F+
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  60   ESIEPVKDSALSFKFWAHENGECKQISLICNRVAE-GVYAVEYDGYNVFRVAETDYKNYA 118
            E I  V +++L +KF    + EC ++S++ ++  + G Y+V YDG+N F + +TDY N+ 
Sbjct  61   EQIH-VLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFL 119
Query  119  IFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQAR 178
            + +L N K   +FQL+ LYGREPD+S +IK RF  +C ++GI   NIID++  +RCLQAR
Sbjct  120  MAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQAR 179

Sequence Alignment: 7. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 128.7 bits 534,  Expect = 1e-31
 Identities = 83/177 46%, Positives = 121/177 68%, Gaps = 3/177 1%
Query  1    MK-LQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFV 59
            MK L LLCLGL L+C + E       NF+ EKI+G W+T+  ASDKRE IE+ G+ R+F+
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  60   ESIEPVKDSALSFKFWAHENGECKQISLICNRVAE-GVYAVEYDGYNVFRVAETDYKNYA 118
            E I  V + +L +KF    + EC ++S++ ++  + G Y+V YDG+N F + +TDY N+ 
Sbjct  61   EQIH-VLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFL 119
Query  119  IFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQAR 178
            + +L N K   +FQL+ LYGREPD+S +IK RF  +C ++GI   NIID++  +RCLQAR
Sbjct  120  MAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQAR 179

Sequence Alignment: 8. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 123.3 bits 510,  Expect = 4e-30
 Identities = 83/166 50%, Positives = 109/166 65%, Gaps = 3/166 1%
Query  11   ILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVESIEPVKDSAL 70
            IL+C    GD     + +  +ISG WY+V  ASD RE IEE GSMRVFVE I   K+S+L
Sbjct  1    ILICAPKRGD--AHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSL 58
Query  71   SFKFWAHENGECKQISLICNRVAEG-VYAVEYDGYNVFRVAETDYKNYAIFQLRNFKAEG 129
            SFKF    NG+C ++ L C+   +  VY VEYDG+NVF + +    +Y IF+L N     
Sbjct  59   SFKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGE 118
Query  130  SFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQAR 178
            SFQL+ELYGR  DV  +I+ +F  +C++ GI E NI+D+T VDRCL AR
Sbjct  119  SFQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYAR 167

Sequence Alignment: 9. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 70.6 bits 279,  Expect = 3e-14
 Identities = 57/175 32%, Positives = 98/175 56%, Gaps = 7/175 4%
Query  1    MKLQLLCLGLILLC-TQG-EGD-EVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRV 57
            M+L LL +GL L+C  Q  EG+ E  +G +  E++SG W++V  AS+K + I+  G  RV
Sbjct  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGL--EELSGRWHSVALASNKSDLIKPWGHFRV 58
Query  58   FVESIEPVKDSALSFKFWAHENGECKQISLICNRVAEGV-YAVEYDGYNVFRVAETDYKN 116
            F+ S+   KD  L       ++G+C+++SL   + A    + +EY G+N + +AE D K+
Sbjct  59   FIHSMS-AKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKS 117
Query  117  YAIFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQ 176
            Y I+ + N   + +  +  L  R+     +    FE  C   G+ +  I+ ++  DRC  
Sbjct  118  YLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQG 177
Query  177  AR 178
            +R
Sbjct  178  SR 179

Sequence Alignment: 10. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 63.3 bits 247,  Expect = 4e-12
 Identities = 50/169 29%, Positives = 84/169 49%, Gaps = 9/169 5%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            +K+ LL L L + C Q +  EV        ++ G W+++  A+D +  + EGG +RV+V+
Sbjct  2    VKFLLLALALGVSCAQHQNLEV-----SPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVK 56
Query  61   SIEPVKDSALSF--KFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYA 118
             +E   D   +F  KF+      C++  ++  +  +G Y  ++ G N F V E    +  
Sbjct  57   HLE-CSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKA-DDTM 114
Query  119  IFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQ 176
             F+  N    G   ++ + G+    S E K RFE    K  I + NI  + T D C Q
Sbjct  115  TFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172

Sequence Alignment: 11. Allergen Name: Bos d 2.0101 Sequence ID: Q28133

 Score = 60.8 bits 236,  Expect = 3e-11
 Identities = 45/169 26%, Positives = 81/169 47%, Gaps = 6/169 3%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            MK  +L L + L+CT  E    +    D  KI G W  +  A+D ++ I EGG +R +  
Sbjct  1    MKAVFLTLLFGLVCTAQETPAEI----DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYR 56
Query  61   SIEPVKDS-ALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAI 119
             IE + D  +LS  F+  + G C  ++ +  R    VY +E+ G N + V     +N  +
Sbjct  57   RIECINDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVS-ENMLV 115
Query  120  FQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRC 174
              + N+  E   ++ E   +    + E   +++ +  + G+   NI ++   D C
Sbjct  116  TYVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170

Sequence Alignment: 12. Allergen Name: Bos d 2.0102 Sequence ID: A59225

 Score = 59.5 bits 230,  Expect = 6e-11
 Identities = 38/146 26%, Positives = 70/146 47%, Gaps = 2/146 1%
Query  28   DAEKISGNWYTVKEASDKRETIEEGGSMRVFVESIEPVKDS-ALSFKFWAHENGECKQIS 86
            D  KI G W  +  A+D ++ I EGG +R +   IE + D  +LS  F+  + G C  ++
Sbjct  8    DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCLLLT 67
Query  87   LICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIFQLRNFKAEGSFQLLELYGREPDVSGE 146
             +  R    VY +E+DG N + V     +N  +  + N+  E   ++ E   +    + E
Sbjct  68   EVAKRQEGYVYVLEFDGTNTLEVIHVS-ENMLVTYVENYDGERITKMTEGLAKGTSFTPE 126
Query  147  IKTRFEDFCHKNGIGEGNIIDMTTVDRC 174
               +++ +  + G+   NI ++   D C
Sbjct  127  ELEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 13. Allergen Name: Bos d 2.0103 Sequence ID: B59225

 Score = 56.3 bits 216,  Expect = 5e-10
 Identities = 37/146 25%, Positives = 68/146 46%, Gaps = 2/146 1%
Query  28   DAEKISGNWYTVKEASDKRETIEEGGSMRVFVESIEPVKDS-ALSFKFWAHENGECKQIS 86
            D  KI G W  +  A+D ++ I EGG +R +   IE + D  +LS  F+  + G C  ++
Sbjct  8    DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCLLLT 67
Query  87   LICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIFQLRNFKAEGSFQLLELYGREPDVSGE 146
             +  R    VY +E+ G N + V     +N  +    N+  E   ++ E   +    + E
Sbjct  68   EVAKRQEGYVYVLEFYGTNTLEVIHVS-ENMLVTYAENYDGERITKMTEGLAKGTSFTPE 126
Query  147  IKTRFEDFCHKNGIGEGNIIDMTTVDRC 174
               +++ +  + G+   NI ++   D C
Sbjct  127  ELEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 14. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 55.5 bits 213,  Expect = 1e-09
 Identities = 46/145 31%, Positives = 76/145 52%, Gaps = 10/145 6%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVK-EASDKRETIEEGGSMRVFV 59
            + L L C    L+ TQ      ++G +D +K++G WY++   ASD      +   +RV+V
Sbjct  6    LALALTCGAQALIVTQ-----TMKG-LDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYV 59
Query  60   ESIEPVKDSALSFKFWAHENGECKQISLICNRVA-EGVYAVEYDGYNVFRVAETDYKNYA 118
            E ++P  +  L   +   ENGEC Q  +I  +     V+ ++    N   V +TDYK Y 
Sbjct  60   EELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYL 119
Query  119  IFQLRNF-KAEGSFQLLELYGREPDVSGEIKTRFE 152
            +F + N  + E S+    L  R P+V  E   +F+
Sbjct  120  LFCMENSAEPEQSLACQCLV-RTPEVDDEALEKFD 153

Sequence Alignment: 15. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 51.9 bits 197,  Expect = 1e-08
 Identities = 44/145 30%, Positives = 74/145 51%, Gaps = 10/145 6%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVK-EASDKRETIEEGGSMRVFV 59
            + L L C    L+ TQ      ++G +D +K++G WY++   ASD      +   +RV+V
Sbjct  6    LALALTCGAQALIVTQ-----TMKG-LDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYV 59
Query  60   ESIEPVKDSALSFKFWAHENGECKQISLICNRVA-EGVYAVEYDGYNVFRVAETDYKNYA 118
            E ++P  +  L   +   EN EC Q  +I  +     V+ ++    N   V +TDYK Y 
Sbjct  60   EELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYL 119
Query  119  IFQLRNFKAEGSFQLL-ELYGREPDVSGEIKTRFE 152
            +  + N  AE    L+ +   R P+V  E   +F+
Sbjct  120  LVCMEN-SAEPEQSLVCQCLVRTPEVDDEALEKFD 153

Sequence Alignment: 16. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 50.1 bits 189,  Expect = 4e-08
 Identities = 40/169 23%, Positives = 79/169 46%, Gaps = 5/169 2%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            MK  LL +G+ L+      D    G  D   +SG WY +K  +  +E  E+  S+   + 
Sbjct  1    MKTLLLTIGFSLIAILQAQDTPALGK-DTVAVSGKWY-LKAMTADQEVPEKPDSVTPMI- 57
Query  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF 120
             ++  K   L  K     NG+C+ I+++ ++ +E      Y+G  V  +  +  +++ I+
Sbjct  58   -LKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYIL 116
Query  121  QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRC 174
                       ++ +L GR+P+ S E    F +F    G+ +  I+++   + C
Sbjct  117  YCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQ-EILELAQSETC 169

Sequence Alignment: 17. Allergen Name: Fel d 7.0101 Sequence ID: ADK56160

 Score = 49.6 bits 187,  Expect = 6e-08
 Identities = 45/170 26%, Positives = 73/170 42%, Gaps = 4/170 2%
Query  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
            MK  LL +GL L+      D    G  D   +SG WY     +D RET  +   + V   
Sbjct  1    MKALLLAVGLSLITVLQAQDPPASGE-DTMAMSGKWYLKAMITD-RETSWKKPEL-VTPM 57
Query  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF 120
            ++  ++   L  +     NG+CK++ LI  + +E      Y G  V  +  T+ K++ IF
Sbjct  58   TLTVLEGGNLKAETTLLTNGQCKEVELILEKTSEPKKYTTYGGKRVVYIEPTEVKDHYIF 117
Query  121  QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRC 174
                       ++ +L GR+P+ + E    F +F    G  +  I      D C
Sbjct  118  YCEGEMQGEQARMAKLVGRDPESNEEALENFREFLRAKGFNQ-EIFSPKQSDTC 170

Sequence Alignment: 18. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 49.0 bits 184,  Expect = 8e-08
 Identities = 37/122 30%, Positives = 62/122 50%, Gaps = 4/122 3%
Query  30   EKISGNWYTVK-EASDKRETIEEGGSMRVFVESIEPVKDSALSFKFWAHENGECKQISLI 88
            +K++G WY++   ASD      +   +RV+VE ++P  +  L   +   EN EC Q  +I
Sbjct  2    QKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKII 61
Query  89   CNRVA-EGVYAVEYDGYNVFRVAETDYKNYAIFQLRNFKAEGSFQLL-ELYGREPDVSGE 146
              +     V+ ++    N   V +TDYK Y +F + N  AE    L+ +   R P+V  E
Sbjct  62   AEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMEN-SAEPEQSLVCQCLVRTPEVDDE 120
Query  147  IKTRFE 152
               +F+
Sbjct  121  ALEKFD 126

Sequence Alignment: 19. Allergen Name: Cav p 3.0101 Sequence ID: CAX62130

 Score = 49.0 bits 184,  Expect = 9e-08
 Identities = 42/164 25%, Positives = 76/164 46%, Gaps = 6/164 3%
Query  11   ILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVESIEPVKD-SA 69
            ILL     G       +D  +I+G W+T+  A+D  E I EGG +R +  ++        
Sbjct  3    ILLLALTIGLAYAHQTLDPSEINGQWHTISIAADNVEKIGEGGPLRGYFHNLHCYDGCKN 62
Query  70   LSFKFWAHENGECKQISLICNRVAEG-VYAVEYDGYNVFRVAETDYKNYAI-FQLRNFKA 127
            + + F+   +G C++  ++  +  +  VY  +Y G N F V     K  AI F   N   
Sbjct  63   IGLTFYVKLDGNCQRFDVLGAKQEDSDVYVAQYSGTNHFEVI--GKKEDAIAFYNHNTDE 120
Query  128  EGS-FQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQ 176
             G   +++ +  R   ++ E + ++++   + GI + NI      D C Q
Sbjct  121  TGKETKMIVVVARRDSLTEEEQQKLQEVAGEKGIPKDNIRYFRERDTCAQ 170

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.