The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLSFSLCIFFLISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHSADLQGLGVISA
NLAIQQGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASAN
VKMSAALDDSVTCEDGFKEKKGIASPVTKENKDYVQLTAISLAITKLLGA
Sequence Info Allergen Name Length Opt Bits Score E Value
ABY21305 Pla or 1.0101 170 1080 253.2 2.8e-69
Q8GT41 Pla a 1 179 989 232.5 5.2e-63
BAC54964 Act d 6.0101 185 265 67.4 2.6e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pla or 1.0101 Sequence ID: ABY21305

 Score = 253.2 bits 1080,  Expect = 3e-69
 Identities = 170/170 100%, Positives = 170/170 100%, Gaps = 0/170 0%
Query  1    MKLSFSLCIFFLISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHSADLQGLGVISA 60
            MKLSFSLCIFFLISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHSADLQGLGVISA
Sbjct  1    MKLSFSLCIFFLISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHSADLQGLGVISA 60
Query  61   NLAIQQGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASAN 120
            NLAIQQGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASAN
Sbjct  61   NLAIQQGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASAN 120
Query  121  VKMSAALDDSVTCEDGFKEKKGIASPVTKENKDYVQLTAISLAITKLLGA 170
            VKMSAALDDSVTCEDGFKEKKGIASPVTKENKDYVQLTAISLAITKLLGA
Sbjct  121  VKMSAALDDSVTCEDGFKEKKGIASPVTKENKDYVQLTAISLAITKLLGA 170

Sequence Alignment: 2. Allergen Name: Pla a 1 Sequence ID: Q8GT41

 Score = 232.5 bits 989,  Expect = 5e-63
 Identities = 166/170 97%, Positives = 169/170 99%, Gaps = 9/170 5%
Query  1    MKLSFSLCIFFL---------ISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHSAD 51
            MKLSFSLCIFF+         ISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSH+AD
Sbjct  1    MKLSFSLCIFFFNLLLLLQAVISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTAD 60
Query  52   LQGLGVISANLAIQQGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADF 111
            LQGLGVISANLAIQ+GSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADF
Sbjct  61   LQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADF 120
Query  112  KSKDYASANVKMSAALDDSVTCEDGFKEKKGIASPVTKENKDYVQLTAISLAITKLLGA 170
            KSKDYASANVKMSAALDDSVTCEDGFKEKKGI SPVTKENKDYVQLTAISLAITKLLGA
Sbjct  121  KSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA 179

Sequence Alignment: 3. Allergen Name: Act d 6.0101 Sequence ID: BAC54964

 Score = 67.4 bits 265,  Expect = 3e-13
 Identities = 50/146 34%, Positives = 77/146 52%, Gaps = 6/146 4%
Query  17   IVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHSADLQGLGVISANLAIQQGSKIQTFIGR 76
            ++   C K   R+P+    +C+++L +DP+S S DL+GLG  S ++A     +    I  
Sbjct  36   LISEICPKT--RNPS----LCLQALESDPRSASKDLKGLGQFSIDIAQASAKQTSKIIAS 89
Query  77   ILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDG 136
            +     DP LK     C   YADA  S+ +A   + S DY S N+  SAA+D + TCED 
Sbjct  90   LTNQATDPKLKGRYETCSENYADAIDSLGQAKQFLTSGDYNSLNIYASAAFDGAGTCEDS 149
Query  137  FKEKKGIASPVTKENKDYVQLTAISLAITKLL 168
            F+    I + + + +     L  I L I+ LL
Sbjct  150  FEGPPNIPTQLHQADLKLEDLCDIVLVISNLL 181

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.