The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLTSLVAVGVGVFLAAALQTCKGFIRDFKTHRQLQEKGDDRAVFCYYGSWATYRWGIAT
FEVDNIDTRLCTHIVYAFTGLRDGVIVSLDEYNDYEENWGKGLMKKFTTLAKNNGIKALV
GLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPEDKDN
FTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDT
VTGLNSPLDSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHG
LGAPILGPGTAGLYTQEAGFLAYYEICSNPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTI
TIKAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKALGRL
Sequence Info Allergen Name Length Opt Bits Score E Value
AKH04311 Per a 12.0101 407 2765 636.6 6.1e-184
AAD52672 Der f 15.0101 555 869 204.4 1.1e-53
Q4JK70 Der p 15.0102 558 869 204.4 1.1e-53
Q4JK69 Der p 15.0101 532 868 204.2 1.2e-53
AII81930 Bla g 12.0101 539 642 152.6 4e-38
AAM19082 Der f 18.0101 462 255 64.4 1.2e-11
Q4JK71 Der p 18.0101 462 243 61.7 8.1e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 12.0101 Sequence ID: AKH04311

 Score = 636.6 bits 2765,  Expect = 6e-184
 Identities = 407/407 100%, Positives = 407/407 100%, Gaps = 0/407 0%
Query  1    MKLTSLVAVGVGVFLAAALQTCKGFIRDFKTHRQLQEKGDDRAVFCYYGSWATYRWGIAT 60
            MKLTSLVAVGVGVFLAAALQTCKGFIRDFKTHRQLQEKGDDRAVFCYYGSWATYRWGIAT
Sbjct  1    MKLTSLVAVGVGVFLAAALQTCKGFIRDFKTHRQLQEKGDDRAVFCYYGSWATYRWGIAT 60
Query  61   FEVDNIDTRLCTHIVYAFTGLRDGVIVSLDEYNDYEENWGKGLMKKFTTLAKNNGIKALV 120
            FEVDNIDTRLCTHIVYAFTGLRDGVIVSLDEYNDYEENWGKGLMKKFTTLAKNNGIKALV
Sbjct  61   FEVDNIDTRLCTHIVYAFTGLRDGVIVSLDEYNDYEENWGKGLMKKFTTLAKNNGIKALV 120
Query  121  GLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPEDKDN 180
            GLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPEDKDN
Sbjct  121  GLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPEDKDN 180
Query  181  FTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDT 240
            FTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDT
Sbjct  181  FTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDT 240
Query  241  VTGLNSPLDSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHG 300
            VTGLNSPLDSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHG
Sbjct  241  VTGLNSPLDSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHG 300
Query  301  LGAPILGPGTAGLYTQEAGFLAYYEICSNPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTI 360
            LGAPILGPGTAGLYTQEAGFLAYYEICSNPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTI
Sbjct  301  LGAPILGPGTAGLYTQEAGFLAYYEICSNPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTI 360
Query  361  TIKAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKALGRL 407
            TIKAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKALGRL
Sbjct  361  TIKAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKALGRL 407

Sequence Alignment: 2. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 204.4 bits 869,  Expect = 1e-53
 Identities = 143/388 36%, Positives = 219/388 56%, Gaps = 14/388 3%
Query  13   VFLAAALQTCKGFIR-DFKTHRQLQEKGDDRAVFCYYGSWATYRWGIATFEVDNIDTRLC 71
            ++   ++  C G++    K       K   R V CY G+W+ Y   +  + +++ID   C
Sbjct  4    IYAILSIMACIGLMNASIKRDHNDYSKNPMRIV-CYVGTWSVYH-KVDPYTIEDIDPFKC 61
Query  72   THIVYAFTGLRDG--VIVSLDEYNDYEEN-WGKGLMKKFTTLA-KNNGIKALVGLGGWNE 127
            TH++Y F  + +    I  +D Y D   N W K   ++F  L  KN  +  ++ LGGW E
Sbjct  62   THLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWYE 121
Query  128  GSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPE-DKDNFTLLLK 186
            GS KYS+MAA    R+ F  S + FLQ+  FDGLDLDWEYP  R G P+ DK N+  L++
Sbjct  122  GSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALVR 181
Query  187  TLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNS 246
             L + +   G +LT AVS        AYD   + K  D++ +M++DYH    +   G N+
Sbjct  182  ELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHG-GWENFYGHNA 240
Query  247  PLDSLPQDTG-YNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHGLGAPI 305
            PL   P +T   +  +NV Y+++ +L  G   +KLV+GVP+YGR + + D  +  LG P 
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
Query  306  LGPGTAGLYTQEAGFLAYYEICS---NPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTITI 362
             G    G+ + E G L+Y E+C      +W++ +++  +  Y Y D  W+ YDD  +I+ 
Sbjct  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  363  KAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKAL 404
            K  ++ E  + GVMVWSLE+DDF G+CG    PLL  V+  +
Sbjct  361  KLAFLKELGVSGVMVWSLENDDFKGHCGP-KNPLLNKVHNMI 401

Sequence Alignment: 3. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 204.4 bits 869,  Expect = 1e-53
 Identities = 144/382 37%, Positives = 218/382 57%, Gaps = 14/382 3%
Query  19   LQTCKGFIRD-FKTHRQLQEKGDDRAVFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYA 77
            L  C G++    K       K   R V CY G+W+ Y   +  + +++ID   CTH++Y 
Sbjct  10   LMACFGLMNAAVKRDHNNYSKNPMRIV-CYVGTWSVYH-KVDPYTIEDIDPFKCTHLMYG 67
Query  78   FTGLRDG--VIVSLDEYNDYEEN-WGKGLMKKFTTLA-KNNGIKALVGLGGWNEGSVKYS 133
            F  + +    I  +D Y D   N W K   ++F  L  KN  +  ++ LGGW EGS KYS
Sbjct  68   FAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWYEGSEKYS 127
Query  134  EMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPE-DKDNFTLLLKTLSEKL 192
            +M A    R+ F  S + FLQ+  FDGLDLDWEYP  R G P+ DK N+  L++ L E +
Sbjct  128  DMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLVRELKEAF 187
Query  193  HARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNSPLDSLP 252
               G +LT AVS        AY++  + +  D++ +M++DYH    + V G N+PL   P
Sbjct  188  EPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHG-GWENVFGHNAPLYKRP 246
Query  253  QDTG-YNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHGLGAPILGPGTA 311
             +T   +  +NV Y+++ +L  G   +KLV+GVP+YGR + + D  +  LG P  G    
Sbjct  247  DETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPAKGMSPP 306
Query  312  GLYTQEAGFLAYYEICS---NPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTITIKAQWVL 368
            G+ T E G L+Y E+C      +W++ +++  +  Y Y D  W+ YDD  +I+ K  ++ 
Sbjct  307  GFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISCKLAFLK 366
Query  369  EKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKAL 404
            E  + GVM+WSLE+DDF G+CG   YPLL  V+  +
Sbjct  367  ELGVSGVMIWSLENDDFKGHCGP-KYPLLNKVHNMI 401

Sequence Alignment: 4. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 204.2 bits 868,  Expect = 1e-53
 Identities = 144/382 37%, Positives = 218/382 57%, Gaps = 14/382 3%
Query  19   LQTCKGFIRD-FKTHRQLQEKGDDRAVFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYA 77
            L  C G++    K       K   R V CY G+W+ Y   +  + +++ID   CTH++Y 
Sbjct  10   LMACFGLMNAAVKRDHNNYSKNPMRIV-CYVGTWSVYH-KVDPYTIEDIDPFKCTHLMYG 67
Query  78   FTGLRDG--VIVSLDEYNDYEEN-WGKGLMKKFTTLA-KNNGIKALVGLGGWNEGSVKYS 133
            F  + +    I  +D Y D   N W K   ++F  L  KN  +  ++ LGGW EGS KYS
Sbjct  68   FAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWYEGSEKYS 127
Query  134  EMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPE-DKDNFTLLLKTLSEKL 192
            +M A    R+ F  S + FLQ+  FDGLDLDWEYP  R G P+ DK N+  L++ L E +
Sbjct  128  DMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLVRELKEAF 187
Query  193  HARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNSPLDSLP 252
               G +LT AVS        AY++  + +  D++ +M++DYH    + V G N+PL   P
Sbjct  188  EPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHG-GWENVFGHNAPLYKRP 246
Query  253  QDTG-YNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHGLGAPILGPGTA 311
             +T   +  +NV Y+++ +L  G   +KLV+GVP+YGR + + D  +  LG P  G    
Sbjct  247  DETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPAKGMSPP 306
Query  312  GLYTQEAGFLAYYEICS---NPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTITIKAQWVL 368
            G+ T E G L+Y E+C      +W++ +++  +  Y Y D  W+ YDD  +I+ K  ++ 
Sbjct  307  GFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISCKLAFLK 366
Query  369  EKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKAL 404
            E  + GVM+WSLE+DDF G+CG   YPLL  V+  +
Sbjct  367  ELGVSGVMIWSLENDDFKGHCGP-KYPLLNKVHNMI 401

Sequence Alignment: 5. Allergen Name: Bla g 12.0101 Sequence ID: AII81930

 Score = 152.6 bits 642,  Expect = 4e-38
 Identities = 137/357 38%, Positives = 214/357 59%, Gaps = 28/357 7%
Query  39   GDDRA-VFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYAFTGLRD---GVIVSLDEYND 94
            GD  + V CY+ +WA YR G+ ++++++I T LCTH++Y+F G+ +   G ++ LD+ ND
Sbjct  23   GDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIGVSNVTWGPLI-LDQEND 81
Query  95   YEENWGKGLMKKFTTLAKNNGIKALVGLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQ 154
             +    +G++  FT L K  G+K  V +GGW EG  KYS + + +  R+TF  + V FL+
Sbjct  82   VDL---RGFLN-FTDL-KAKGVKTSVAMGGWGEGGRKYSHLVSDKKLRDTFIPALVEFLH 136
Query  155  KQGFDGLDLDWEYP--ARRGGVPEDKDNFTLLLKTLSEKL--HARGLILTVAVSADPKTA 210
            K  FDGLD+DWEYP  + RGG   D+ NF  +++ L   +    +G  +T+AV       
Sbjct  137  KYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWEITMAVPLANFRL 196
Query  211  ANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNSPLDSLPQDTGYN-KKLNVKYSVNQ 269
               Y  P++ +  D + +M++D     +     ++SPL   P + GY  + LN    +  
Sbjct  197  NEGYHVPDLCELIDAVHVMAYDLRGNWAG-FADVHSPLYQRPNE-GYGYQALNDNDGMQL 254
Query  270  WLKGGVPPNKLVLGVPLYGRTYRLADPDQH-GLGAPI---LGPGTAGLYTQEAGFLAYYE 325
            W+  G  P+KLVLG P+YGRT+ L+  + +  +G  I    G G AG YT   G LAYYE
Sbjct  255  WVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYTGAKGMLAYYE 314
Query  326  ICS-----NPDWNVVWNDTSSYLYAYKD-YQWLSYDDPNTITIKAQWVLEKNLGGVMVWS 379
            IC+        W   ++D     YAY D  QW+ YD+  ++  K  ++ EK   G M W+
Sbjct  315  ICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMDFIKEKGYLGAMTWA 374
Query  380  LESDDFHGNCGKGAYPLLTAVNKAL 404
            ++ DDFHG CG+   PL+  + K +
Sbjct  375  IDMDDFHGTCGQ-KNPLINVLAKNM 398

Sequence Alignment: 6. Allergen Name: Der f 18.0101 Sequence ID: AAM19082

 Score = 64.4 bits 255,  Expect = 1e-11
 Identities = 121/325 37%, Positives = 200/325 61%, Gaps = 44/325 13%
Query  46   CYYGSWATYRWGIATFEVDNIDTRLCTHIVYAFTGLRDGV--IVSLDEY--NDYEENWGK 101
            CYY SW  +R G    + ++IDT LCTHIVY++ G+      I  LDEY   D  +    
Sbjct  33   CYYESWVHWRQGEGKMDPEDIDTSLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHD---- 88
Query  102  GLMKKFTTLAKNNGIKALVGLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGL 161
              M+ FT   K N  KA++ +GG +  S ++S+ AA +  RETF  S V ++ + GFDG+
Sbjct  89   --MEHFTQ-HKGNA-KAMIAVGG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGV 143
Query  162  DLDWEYPARRGGVPEDKDNFTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAK 221
             +DW      G   +D DNF  LL  + EK+    +++ V + A   +  N Y+ P ++ 
Sbjct  144  MIDWS-----GMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTLPATIASYDN-YNIPAISN 197
Query  222  YADYITLMSFDYHTPSSDTVTGLNSPL-DSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKL 280
            Y D++ ++S+DY    + TV G  SP+ + L     Y+K+             G P +K+
Sbjct  198  YVDFMNVLSLDYTGSWAHTV-GHASPFPEQLKTLEAYHKR-------------GAPRHKM 243
Query  281  VLGVPLYGRTYRLADPDQHGLGAPILGPGTAGLYTQEAGFLAYYEICSN--PDWNVVW-- 336
            V+ VP+Y RT+ L   +++ +G    GPG  G +TQ  GFL+Y E+C     + N     
Sbjct  244  VMAVPFYARTWILEKMNKQDIGDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTIT 303
Query  337  ---NDTSSY-LYAYKDY-QWLSYDDPNTITIKAQWVLEKNLGGVMVWSLESDDFHGNCGK 391
               ++T+ Y +Y + ++ +W+S++D +T+  KA+ + ++   G+ V++L ++D HG CG 
Sbjct  304  RDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGD 363
Query  392  GAYPLLTAV 400
               PLL A+
Sbjct  364  -KNPLLHAI 371

Sequence Alignment: 7. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 61.7 bits 243,  Expect = 8e-11
 Identities = 122/337 36%, Positives = 201/337 59%, Gaps = 42/337 12%
Query  41   DRAVFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYAFTGLRDGV--IVSLDEYNDYEEN 98
            D    CYY SW  +R G    + ++IDT LC+HIVY++ G+      I  LD+Y     +
Sbjct  28   DPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSHIVYSYFGIDASSHEIKLLDQYLMITLH 87
Query  99   WGKGLMKKFTTLAKNNG-IKALVGLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQG 157
                 M+ FT   K+ G  KA++ +GG +  S ++S+ AA +  RETF  S + ++ K G
Sbjct  88   ----DMEHFT---KHKGNAKAMIAVGGASM-SDQFSKTAAVEHYRETFVVSTIDLMTKYG 139
Query  158  FDGLDLDWEYPARRGGVPEDKDNFTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFP 217
            FDG+ +DW      G   +D DNF  LL  + EK+    +++ V + A   +  N Y+ P
Sbjct  140  FDGVMIDWS-----GMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTLPATIASYDN-YNIP 193
Query  218  NVAKYADYITLMSFDYHTPSSDTVTGLNSPL-DSLPQDTGYNKKLNVKYSVNQWLKGGVP 276
             ++ Y D++ ++++DY  P + TV G  S L + L     YNK+             G P
Sbjct  194  AISNYVDFMNVLTLDYDGPWAYTV-GHASALPEQLKTLEAYNKR-------------GAP 239
Query  277  PNKLVLGVPLYGRTYRLADPDQHGLGAPILGPGTAGLYTQEAGFLAYYEICSNPD----- 331
             +K+V+ VP++ RT+ L   D++ +G    GPG  G +TQ  GFL+Y E+C         
Sbjct  240  RHKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAETNA 299
Query  332  WNVVWNDTSSYLYAY----KDYQWLSYDDPNTITIKAQWVLEKNLGGVMVWSLESDDFHG 387
            +++  +  ++ +YA        +W+S++D +T+  KA+ + E+  GG+ V++L ++D HG
Sbjct  300  FSITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHG 359
Query  388  NCGKGAYPLLTAVNKALGR 406
             CG    PLL A+N    R
Sbjct  360  VCGD-KNPLLHAINSNYFR 377

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.