The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGN
ERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVV
EDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDD
GTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB23464 Gly m TI 216 1452 337.8 1.6e-94
CAA45777 Gly m TI 217 1440 335.0 1.1e-93
CAA45778 Gly m TI 217 1387 323.0 4.6e-90
P01071 Gly m TI 181 1178 275.4 7.8e-76
AAB23482 Gly m TI 203 845 199.5 6.5e-53
AAB23483 Gly m TI 204 778 184.2 2.6e-48
CAA56343 Gly m TI 208 504 121.7 1.7e-29
CAA45723 Sola t 4 217 182 48.3 2.2e-07
O24383 Sola t 3.0101 186 146 40.2 5.3e-05
P16348 Sola t 2 188 139 38.6 0.00016
P30941 Sola t 4 221 138 38.3 0.00024
P20347 Sola t 3.0102 222 132 36.9 0.00062
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m TI Sequence ID: AAB23464

 Score = 337.8 bits 1452,  Expect = 2e-94
 Identities = 216/216 100%, Positives = 216/216 100%, Gaps = 0/216 0%
Query  1    MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGN 60
            MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGN
Sbjct  1    MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGN 60
Query  61   ERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVV 120
            ERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVV
Sbjct  61   ERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVV 120
Query  121  EDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDD 180
            EDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDD
Sbjct  121  EDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDD 180
Query  181  GTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE 216
            GTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE
Sbjct  181  GTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE 216

Sequence Alignment: 2. Allergen Name: Gly m TI Sequence ID: CAA45777

 Score = 335.0 bits 1440,  Expect = 1e-93
 Identities = 216/216 100%, Positives = 216/216 100%, Gaps = 1/216 0%
Query  1    MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTG 59
            MKSTIFF LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTG
Sbjct  1    MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTG 60
Query  60   NERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV 119
            NERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV
Sbjct  61   NERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV 120
Query  120  VEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHD 179
            VEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHD
Sbjct  121  VEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHD 180
Query  180  DGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE 216
            DGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE
Sbjct  181  DGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE 217

Sequence Alignment: 3. Allergen Name: Gly m TI Sequence ID: CAA45778

 Score = 323.0 bits 1387,  Expect = 5e-90
 Identities = 207/216 95%, Positives = 214/216 99%, Gaps = 1/216 0%
Query  1    MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTG 59
            MKSTIFF LFLFCAFTTSYLPSAIADFVLDNEGNPL++GGTYYILSDITAFGGIRAAPTG
Sbjct  1    MKSTIFFALFLFCAFTTSYLPSAIADFVLDNEGNPLDSGGTYYILSDITAFGGIRAAPTG 60
Query  60   NERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV 119
            NERCPLTVVQSRNELDKGIGTIISSP+RIRFIAEG+PL LKFDSFAVIMLCVGIPTEWSV
Sbjct  61   NERCPLTVVQSRNELDKGIGTIISSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSV 120
Query  120  VEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHD 179
            VEDLPEGPAVKIGENKDA+DGWFR+ERVSDDEFNNYKLVFC QQAEDDKCGDIGISIDHD
Sbjct  121  VEDLPEGPAVKIGENKDAVDGWFRIERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHD 180
Query  180  DGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE 216
            DGTRRLVVSKNKPLVVQFQK+DKESLAKKNHGLSRSE
Sbjct  181  DGTRRLVVSKNKPLVVQFQKVDKESLAKKNHGLSRSE 217

Sequence Alignment: 4. Allergen Name: Gly m TI Sequence ID: P01071

 Score = 275.4 bits 1178,  Expect = 8e-76
 Identities = 173/181 95%, Positives = 178/181 98%, Gaps = 0/181 0%
Query  25   DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 84
            DFVLDNEGNPL NGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
Sbjct  1    DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
Query  85   PYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRL 144
            P+RIRFIAEG+PL LKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDA+DGWFR+
Sbjct  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 120
Query  145  ERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKES 204
            ERVSDDEFNNYKLVFC QQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQK+DKES
Sbjct  121  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 180
Query  205  L 205
            L
Sbjct  181  L 181

Sequence Alignment: 5. Allergen Name: Gly m TI Sequence ID: AAB23482

 Score = 199.5 bits 845,  Expect = 7e-53
 Identities = 136/195 69%, Positives = 157/195 80%, Gaps = 8/195 4%
Query  1    MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPT 58
            MKSTIFF LFL CAFT SYLPSA A FVLD + +PL+NGGTYY+L  +   GG I    T
Sbjct  1    MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDST 60
Query  59   GNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWS 118
            G E CPLTVVQS NELDKGIG + +SP    FIAE +PLS+KF SFAVI LC G+PTEW+
Sbjct  61   GKEICPLTVVQSPNELDKGIGLVFTSPLHALFIAERYPLSIKFGSFAVITLCAGMPTEWA 120
Query  119  VVEDLPEG-PAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISID 177
            +VE   EG  AVK+   +D +DGWF +ERVS  E+N+YKLVFCPQQAED+KC DIGI ID
Sbjct  121  IVER--EGLQAVKLAA-RDTVDGWFNIERVSR-EYNDYKLVFCPQQAEDNKCEDIGIQID 176
Query  178  HDDGTRRLVVSKNKPLVVQFQKL 200
             DDG RRLV+SKNKPLVVQFQK+
Sbjct  177  -DDGIRRLVLSKNKPLVVQFQKF 198

Sequence Alignment: 6. Allergen Name: Gly m TI Sequence ID: AAB23483

 Score = 184.2 bits 778,  Expect = 3e-48
 Identities = 124/197 62%, Positives = 149/197 75%, Gaps = 5/197 2%
Query  1    MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITA-FGGIRAAPT 58
            MKSTIFF LFL CAFT SYLPSA A FVLD + +PL+NGGTYY+L  +    GGI    T
Sbjct  1    MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKSGGIEGNST 60
Query  59   GNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWS 118
            G E CPLTVVQS N+ +KGIG +  SP    FIAE +PLS+KFDSFAVI LC  +PT+W+
Sbjct  61   GKEICPLTVVQSPNKHNKGIGLVFKSPLHALFIAERYPLSIKFDSFAVIPLCGVMPTKWA 120
Query  119  VVEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDH 178
            +VE   EG        +D +DGWF +ERVS +  + YKLVFCPQ+AED+KC DIGI ID 
Sbjct  121  IVER--EGLQAVTLAARDTVDGWFNIERVSREYNDYYKLVFCPQEAEDNKCEDIGIQID- 177
Query  179  DDGTRRLVVSKNKPLVVQFQKL 200
            +DG RRLV+SKNKPLVV+FQK+
Sbjct  178  NDGIRRLVLSKNKPLVVEFQKF 199

Sequence Alignment: 7. Allergen Name: Gly m TI Sequence ID: CAA56343

 Score = 121.7 bits 504,  Expect = 2e-29
 Identities = 99/192 51%, Positives = 125/192 65%, Gaps = 18/192 9%
Query  1    MKSTIFF-LFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGG-IRAAPT 58
            MKST  + LFL+CA+T+SY PSA AD V+D EGNP+ NGGTYY+L  I   GG I  A T
Sbjct  1    MKSTTSLALFLLCALTSSYQPSATADIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKT 60
Query  59   GNERCPLTVVQSRNE-LDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEW 117
              E CPLTVVQS  E L +G+  IISSP++I  I EG  LSLKF       LC  +    
Sbjct  61   ETETCPLTVVQSPFEGLQRGLPLIISSPFKILDITEGLILSLKFH------LCTPLSLNS 114
Query  118  SVVEDLPEGPAVKIGENKDAMDG----WFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIG 173
              V+   +G A +       +      WFR++R S  E N YKLVFC    +D  CGDI 
Sbjct  115  FSVDRYSQGSARRTPCQTHWLQKHNRCWFRIQRASS-ESNYYKLVFCTSN-DDSSCGDIV 172
Query  174  ISIDHDDGTRRLVVS--KNKPLVVQFQKLD 201
              ID + G R L+V+  +N PL+VQFQK++
Sbjct  173  APIDRE-GNRPLIVTHDQNHPLLVQFQKVE 201

Sequence Alignment: 8. Allergen Name: Sola t 4 Sequence ID: CAA45723

 Score = 48.3 bits 182,  Expect = 2e-07
 Identities = 57/187 30%, Positives = 97/187 51%, Gaps = 24/187 12%
Query  5    IFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDI-TAFGG---IRAAPTGN 60
            + F   F +     LPS  A  VLD  G  L++  +Y I+S    A+GG   +  +P  +
Sbjct  15   VVFSSTFTSKNPINLPSD-ATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSD 73
Query  61   ERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVV 120
              C   + +  +++    GT +   +  + I E   L+++F + +   LCV   T W V 
Sbjct  74   APCANGIFRYNSDVGPS-GTPVRFSHFGQGIFENELLNIQF-AISTSKLCVSY-TIWKVG 130
Query  121  E-DLPEGPAV--KIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAE-------DDK-C 169
            + D   G  +    G    A   WF++  V   +F  Y L++CP  +        DD+ C
Sbjct  131  DYDASLGTMLLETGGTIGQADSSWFKI--VKSSQFG-YNLLYCPVTSTMSCPFSSDDQFC 187
Query  170  GDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 200
              +G+   H +G RRL + K+ PL V F+++
Sbjct  188  LKVGVV--HQNGKRRLALVKDNPLDVSFKQV 216

Sequence Alignment: 9. Allergen Name: Sola t 3.0101 Sequence ID: O24383

 Score = 40.2 bits 146,  Expect = 5e-05
 Identities = 47/161 29%, Positives = 73/161 45%, Gaps = 18/161 11%
Query  27   VLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 83
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L KG   +  
Sbjct  13   VYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVFI 72
Query  84   SPYRIRFIAEGHPLSLKFDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGW 141
                  +      ++  +  F V    LCV   T W V  +      V  G N    +  
Sbjct  73   RKSESDYGDVVRLMTAVYIKFFVKTTKLCVD-ETVWKVNNE----QLVVTGGNVGNENDI 127
Query  142  FRLER---VSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQF 197
            F++++   V     N YKL+ CP + E   C +IG   +  +G  RLV   ++   + F
Sbjct  128  FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIG--SNFKNGYPRLVTVNDEKDFIPF 181

Sequence Alignment: 10. Allergen Name: Sola t 2 Sequence ID: P16348

 Score = 38.6 bits 139,  Expect = 0.0002
 Identities = 50/166 30%, Positives = 86/166 51%, Gaps = 23/166 13%
Query  27   VLDNEGNPLENGGTYYILS-DITAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 82
            VLD  G  L    +Y I+S    A+GG   +  +P  +  CP  V +  +++    GT +
Sbjct  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPS-GTPV 66
Query  83   SSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV--VEDLPEGPAVKIGENKDAMDG 140
                    I E + L+++F+  A + LCV   T W V  +        ++ G      D 
Sbjct  67   RFIPLSGGIFEDQLLNIQFN-IATVKLCVSY-TIWKVGNLNAYFRTMLLETGGTIGQADS 124
Query  141  -WFRLERVSDDEFNNYKLVFCPQQA--------EDDKCGDIGISIDHDDGTRRLVVSKNK 191
             +F++ ++S+  F  Y L++CP           +D+ C  +G+ I   +G RRL +    
Sbjct  125  SYFKIVKLSN--FG-YNLLYCPITPPFLCPFCRDDNFCAKVGVVI--QNGKRRLALVNEN 179
Query  192  PLVVQFQKL 200
            PL V FQ++
Sbjct  180  PLDVLFQEV 188

Sequence Alignment: 11. Allergen Name: Sola t 4 Sequence ID: P30941

 Score = 38.3 bits 138,  Expect = 0.0002
 Identities = 59/187 31%, Positives = 99/187 52%, Gaps = 28/187 14%
Query  5    IFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDI-TAFGG---IRAAPTGN 60
            + F   F +     LPS  A  VLD  G  L++  +Y I+S    A+GG   +  +P  +
Sbjct  15   VVFSSTFTSKNPINLPSD-ATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSD 73
Query  61   ERCPLTVVQSRNELDKGIGTII----SSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTE 116
              C   + +  +++    GT +    SS +  + I E   L+++F + +   LCV   T 
Sbjct  74   APCANGIFRYNSDVGPS-GTPVRFIGSSSHFGQGIFENELLNIQF-AISTSKLCVSY-TI 130
Query  117  WSVVE-DLPEGPAV--KIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAE-------D 166
            W V + D   G  +    G    A   WF++  V   +F  Y L++CP  +        D
Sbjct  131  WKVGDYDASLGTMLLETGGTIGQADSSWFKI--VKSSQFG-YNLLYCPVTSTMSCPFSSD 187
Query  167  DK-CGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 200
            D+ C  +G+   H +G RRL + K+ PL V F+++
Sbjct  188  DQFCLKVGVV--HQNGKRRLALVKDNPLDVSFKQV 220

Sequence Alignment: 12. Allergen Name: Sola t 3.0102 Sequence ID: P20347

 Score = 36.9 bits 132,  Expect = 0.0006
 Identities = 44/161 27%, Positives = 72/161 44%, Gaps = 14/161 8%
Query  27   VLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 83
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L +G   +  
Sbjct  48   VYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFV 107
Query  84   SPYRIRFIAEGHPLSLKFDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGW 141
                  +      +++ +  F V    LCV   T W V ++       K+G   D     
Sbjct  108  RKSESDYGDVVRVMTVVYIKFFVKTTKLCVD-QTVWKVNDEQLVVTGGKVGNENDIFK-I 165
Query  142  FRLERVSDDEFNN-YKLVFCPQQAEDDKCGDIGISIDHDDGTRRLV-VSKNKPLV 194
             + + V+       YKL+ CP +     C +IG   +  +G  RLV V  +K ++
Sbjct  166  MKTDLVTPGGSKYVYKLLHCPSHL---GCKNIG--GNFKNGYPRLVTVDDDKDFI 215

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.