The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF
SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS
CVRKKGVLELTVYGKKK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF65313 Sol g 4.0201 137 902 212.9 2.4e-57
Q9NH75 Sol g 4.0101 137 883 208.6 4.8e-56
AAC97370 Sol i 4 137 827 195.8 3.4e-52
P35777 Sol i 4 137 811 192.2 4.2e-51
AAY32926 Sol g 2.0101 138 429 105.1 7e-25
P35775 Sol i 2 138 387 95.5 5.3e-22
ABC58726 Sol s 2.0101 138 367 91.0 1.3e-20
P35776 Sol r 2 119 303 76.5 2.4e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sol g 4.0201 Sequence ID: AAF65313

 Score = 212.9 bits 902,  Expect = 2e-57
 Identities = 137/137 100%, Positives = 137/137 100%, Gaps = 0/137 0%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF
Sbjct  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
Query  61   SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS 120
            SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS
Sbjct  61   SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS 120
Query  121  CVRKKGVLELTVYGKKK 137
            CVRKKGVLELTVYGKKK
Sbjct  121  CVRKKGVLELTVYGKKK 137

Sequence Alignment: 2. Allergen Name: Sol g 4.0101 Sequence ID: Q9NH75

 Score = 208.6 bits 883,  Expect = 5e-56
 Identities = 134/137 97%, Positives = 136/137 99%, Gaps = 0/137 0%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MKTFVLVSCLLVFTQIIYAVDIKELKI+NRIL+KCIRTVPKGENDPINPLKNVNVLYCAF
Sbjct  1    MKTFVLVSCLLVFTQIIYAVDIKELKIMNRILEKCIRTVPKGENDPINPLKNVNVLYCAF 60
Query  61   SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS 120
            SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS
Sbjct  61   SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS 120
Query  121  CVRKKGVLELTVYGKKK 137
            CV KKGVLELTVYGKKK
Sbjct  121  CVLKKGVLELTVYGKKK 137

Sequence Alignment: 3. Allergen Name: Sol i 4 Sequence ID: AAC97370

 Score = 195.8 bits 827,  Expect = 3e-52
 Identities = 123/137 89%, Positives = 132/137 96%, Gaps = 0/137 0%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MKTFVLVSCLLVFTQIIYA+DIKE+ I+NRIL+KCIRTVPK ENDPINPLKNVNVLYCAF
Sbjct  1    MKTFVLVSCLLVFTQIIYALDIKEISIMNRILEKCIRTVPKRENDPINPLKNVNVLYCAF 60
Query  61   SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS 120
            +KRGIFTPKGVNTKQYINYCEKTII+PADIK CKK+ SKC+KKVYDRPGPIIERSKNLLS
Sbjct  61   TKRGIFTPKGVNTKQYINYCEKTIISPADIKLCKKIASKCVKKVYDRPGPIIERSKNLLS 120
Query  121  CVRKKGVLELTVYGKKK 137
            CV KKG+LELTVYGKKK
Sbjct  121  CVLKKGLLELTVYGKKK 137

Sequence Alignment: 4. Allergen Name: Sol i 4 Sequence ID: P35777

 Score = 192.2 bits 811,  Expect = 4e-51
 Identities = 120/137 87%, Positives = 130/137 94%, Gaps = 0/137 0%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MKTFVLVSCLLVFTQIIYA+DIKE+ I+NRIL+KCIRTVPK ENDPINPL+NVNV YCAF
Sbjct  1    MKTFVLVSCLLVFTQIIYALDIKEISIMNRILEKCIRTVPKRENDPINPLRNVNVWYCAF 60
Query  61   SKRGIFTPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLS 120
            +KRGIFTPKGVNTKQYINYCEKT I+PADIK CKK+ SKC+KKVYDRPGPIIERSKNLLS
Sbjct  61   TKRGIFTPKGVNTKQYINYCEKTAISPADIKLCKKIASKCVKKVYDRPGPIIERSKNLLS 120
Query  121  CVRKKGVLELTVYGKKK 137
            CV KKG+LELTVYGKKK
Sbjct  121  CVLKKGLLELTVYGKKK 137

Sequence Alignment: 5. Allergen Name: Sol g 2.0101 Sequence ID: AAY32926

 Score = 105.1 bits 429,  Expect = 7e-25
 Identities = 62/135 45%, Positives = 95/135 70%, Gaps = 5/135 3%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MK+FVL +CLLVF QIIYA D ++LK++ + + +C RT+PK EN P +PL  V+VL+C +
Sbjct  1    MKSFVLATCLLVFAQIIYA-DTEKLKVLRKDIAECARTLPKCENQPDDPLARVDVLHCVL 59
Query  61   SKRGIF---TPKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKN 117
            +KRG+F    P  +  K    YC  TI +PAD++ CKK++S+C+ K   RP    +++ N
Sbjct  60   AKRGVFDDPAPAAIKKKDE-KYCAITITDPADVENCKKVVSRCVDKETQRPRSNRQKAIN 118
Query  118  LLSCVRKKGVLELTVYGKKK 137
            +++C+ + GV E TV  +KK
Sbjct  119  IVACILRSGVAETTVLARKK 138

Sequence Alignment: 6. Allergen Name: Sol i 2 Sequence ID: P35775

 Score = 95.5 bits 387,  Expect = 5e-22
 Identities = 61/134 45%, Positives = 90/134 67%, Gaps = 7/134 5%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MK+FVL +CLL F QIIYA D KELKI+ + + +C+RT+PK  N P +PL  V+V +CA 
Sbjct  1    MKSFVLATCLLGFAQIIYA-DNKELKIIRKDVAECLRTLPKCGNQPDDPLARVDVWHCAM 59
Query  61   SKRGIF-TPKGVNTKQY-INYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSK-- 116
            +KRG++  P     K+  +  C K I +PA+++ CKK+ S+C+ +  +  GP   R K  
Sbjct  60   AKRGVYDNPDPAVIKERSMKMCTKIITDPANVENCKKVASRCVDR--ETQGPKSNRQKAV 117
Query  117  NLLSCVRKKGVLELTVYGKKK 137
            N++ C  + GV E TV  +KK
Sbjct  118  NIIGCALRAGVAETTVLARKK 138

Sequence Alignment: 7. Allergen Name: Sol s 2.0101 Sequence ID: ABC58726

 Score = 91.0 bits 367,  Expect = 1e-20
 Identities = 55/135 40%, Positives = 89/135 65%, Gaps = 5/135 3%
Query  1    MKTFVLVSCLLVFTQIIYAVDIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAF 60
            MK+FVL +CLL F QIIYA D ++LKI+ + + KC RT+PK  N P +PL  V+V +CA+
Sbjct  1    MKSFVLATCLLGFAQIIYA-DTEKLKILRKDIAKCARTLPKCVNQPDDPLARVDVWHCAL 59
Query  61   SKRGIFT---PKGVNTKQYINYCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKN 117
            +K G+F    P  +  K+Y  +C   + +PA+++ CKK+ S+C+ K         +++ N
Sbjct  60   AKSGVFDDPDPAAIK-KKYKKFCAIAVTDPANVENCKKVTSRCVDKETQCSKSNRQKAIN 118
Query  118  LLSCVRKKGVLELTVYGKKK 137
            + +C+ + GV E TV  ++K
Sbjct  119  IAACILRSGVTETTVLAREK 138

Sequence Alignment: 8. Allergen Name: Sol r 2 Sequence ID: P35776

 Score = 76.5 bits 303,  Expect = 2e-16
 Identities = 42/117 35%, Positives = 74/117 63%, Gaps = 2/117 1%
Query  21   DIKELKIVNRILKKCIRTVPKGENDPINPLKNVNVLYCAFSKRGIF-TPKGVNTKQYIN- 78
            DI+  +++ + + +C RT+PK  N P +PL  V+V +CA SKRG++  P     K+  + 
Sbjct  1    DIEAQRVLRKDIAECARTLPKCVNQPDDPLARVDVWHCAMSKRGVYDNPDPAVVKEKNSK 60
Query  79   YCEKTIINPADIKQCKKLISKCIKKVYDRPGPIIERSKNLLSCVRKKGVLELTVYGKKK 137
             C K I +PAD++ CKK++S+C+ +   RP    +++ N+  C+ + GV+E TV  ++K
Sbjct  61   MCPKIITDPADVENCKKVVSRCVDRETQRPRSNRQKAINITGCILRAGVVEATVLAREK 119

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.