The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY
EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV
RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA
PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA
KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP
TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTT
STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM
PCPPGTIWCQEKLTCITE
Sequence Info Allergen Name Length Opt Bits Score E Value
Q4JK70 Der p 15.0102 558 3919 899.5 0
AAD52672 Der f 15.0101 555 3571 820.2 0
Q4JK69 Der p 15.0101 532 3240 744.8 3.1e-216
AKH04311 Per a 12.0101 407 869 204.4 1.1e-53
AII81930 Bla g 12.0101 539 785 185.2 9e-48
AAM19082 Der f 18.0101 462 319 79.0 7.1e-16
Q4JK71 Der p 18.0101 462 318 78.7 8.3e-16
ALU66112 Der f 23.0101 174 211 54.8 4.9e-09
Q17282 Blo t 12 144 142 39.3 0.00019
AAC61261 Asp f 16 427 127 35.2 0.0097
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 899.5 bits 3919,  Expect = 0
 Identities = 558/558 100%, Positives = 558/558 100%, Gaps = 0/558 0%
Query  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
            MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
Sbjct  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
Query  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
            CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY
Sbjct  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
Query  121  EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
            EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV
Sbjct  121  EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
Query  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
            RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA
Sbjct  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
            PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
Query  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
            KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
Sbjct  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
            KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP
Sbjct  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
Query  421  TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTT 480
            TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTT
Sbjct  421  TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTT 480
Query  481  STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM 540
            STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM
Sbjct  481  STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM 540
Query  541  PCPPGTIWCQEKLTCITE 558
            PCPPGTIWCQEKLTCITE
Sbjct  541  PCPPGTIWCQEKLTCITE 558

Sequence Alignment: 2. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 820.2 bits 3571,  Expect = 0
 Identities = 506/552 91%, Positives = 533/552 96%, Gaps = 9/552 1%
Query  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
            MKT  AIL +MAC GLMNA++KRDHN+YSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
Sbjct  1    MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
Query  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
            CTHLMYGFAKIDEYKYTIQVFDPYQDDNHN+WEK GYERFNNLRLKNPELTTMISLGGWY
Sbjct  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY 120
Query  121  EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
            EGSEKYSDM ANPTYRQQF+QSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL LV
Sbjct  121  EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV 180
Query  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
            RELK+AFEP GYLLTAAVSPGKDKID AY++KELN+LFDWMNVMTYDYHGGWEN +GHNA
Sbjct  181  RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA 240
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
            PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSK+KLGDPA
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
Query  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
            KGMSPPGFI+GEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
Sbjct  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
            KLAFLKELGVSGVM+WSLENDDFKGHCGPK PLLNKVHNMINGDEKNS+EC+LGPSTTTP
Sbjct  361  KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP 420
Query  421  TPTT-PSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPST-PSTTTPTPTTPS 478
            TPTT P+TP TTTPT  +P+TP TTTP+PTTP    TTTP+PTTP+T PS TTPTPTTP+
Sbjct  421  TPTTTPTTP-TTTPTTPSPTTP-TTTPSPTTP----TTTPSPTTPTTTPSPTTPTPTTPT 474
Query  479  TTSTT-TPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWV 537
               TT TP+PTTT+ TSETPKYTTYVDGHLIKCYKEGD+PHPTNIHKYLVCE+VNGGWWV
Sbjct  475  PAPTTSTPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWV 534
Query  538  HIMPCPPGTIWCQEKLTCITE 558
            HIMPCPPGTIWCQEKLTCI E
Sbjct  535  HIMPCPPGTIWCQEKLTCIGE 555

Sequence Alignment: 3. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 744.8 bits 3240,  Expect = 3e-216
 Identities = 531/532 99%, Positives = 532/532 100%, Gaps = 26/532 4%
Query  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
            MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
Sbjct  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
Query  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
            CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY
Sbjct  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
Query  121  EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
            EGSEKYSDMVANPTYR+QFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV
Sbjct  121  EGSEKYSDMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
Query  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
            RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA
Sbjct  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
            PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
Query  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
            KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
Sbjct  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
            KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP
Sbjct  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
Query  421  TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTT 480
            TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPT                  
Sbjct  421  TPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPT------------------ 462
Query  481  STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM 540
                    TTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM
Sbjct  463  --------TTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM 514
Query  541  PCPPGTIWCQEKLTCITE 558
            PCPPGTIWCQEKLTCITE
Sbjct  515  PCPPGTIWCQEKLTCITE 532

Sequence Alignment: 4. Allergen Name: Per a 12.0101 Sequence ID: AKH04311

 Score = 204.4 bits 869,  Expect = 1e-53
 Identities = 144/382 37%, Positives = 218/382 57%, Gaps = 14/382 3%
Query  10   LMACFGLMNAAVKRDHNNYSKNPMRIV-CYVGTWSVYH-KVDPYTIEDIDPFKCTHLMYG 67
            L  C G++    K       K   R V CY G+W+ Y   +  + +++ID   CTH++Y 
Sbjct  19   LQTCKGFIRD-FKTHRQLQEKGDDRAVFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYA 77
Query  68   FAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWYEGSEKYS 127
            F  + +    I  +D Y D   N W K   ++F  L  KN  +  ++ LGGW EGS KYS
Sbjct  78   FTGLRDG--VIVSLDEYNDYEEN-WGKGLMKKFTTLA-KNNGIKALVGLGGWNEGSVKYS 133
Query  128  DMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLVRELKEAF 187
            +M A    R+ F  S + FLQ+  FDGLDLDWEYP  R G P+ DK N+  L++ L E +
Sbjct  134  EMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPE-DKDNFTLLLKTLSEKL 192
Query  188  EPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHG-GWENVFGHNAPLYKRP 246
               G +LT AVS        AY++  + +  D++ +M++DYH    + V G N+PL   P
Sbjct  193  HARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNSPLDSLP 252
Query  247  DETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPAKGMSPP 306
             +T   +  +NV Y+++ +L  G   +KLV+GVP+YGR + + D  +  LG P  G    
Sbjct  253  QDTG-YNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHGLGAPILGPGTA 311
Query  307  GFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISCKLAFLK 366
            G+ T E G L+Y E+C      +W++ +++  +  Y Y D  W+ YDD  +I+ K  ++ 
Sbjct  312  GLYTQEAGFLAYYEICS---NPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTITIKAQWVL 368
Query  367  ELGVSGVMIWSLENDDFKGHCGP-KYPLLNKVHNMI 401
            E  + GVM+WSLE+DDF G+CG   YPLL  V+  +
Sbjct  369  EKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKAL 404

Sequence Alignment: 5. Allergen Name: Bla g 12.0101 Sequence ID: AII81930

 Score = 185.2 bits 785,  Expect = 9e-48
 Identities = 202/514 39%, Positives = 300/514 58%, Gaps = 52/514 10%
Query  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHK-VDPYTIEDIDPF 59
            MKTS    IL  C G++  +V    +     P R+VCY   W+VY   +  Y IEDI   
Sbjct  1    MKTS---QILFLC-GVVFLSVLV--STSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTD 54
Query  60   KCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGW 119
             CTHL+Y F  +    +      P   D  N  +  G+  F +L+ K   + T +++GGW
Sbjct  55   LCTHLIYSFIGVSNVTW-----GPLILDQENDVDLRGFLNFTDLKAKG--VKTSVAMGGW 107
Query  120  YEGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPG-SRLGNPKIDKQNYLT 178
             EG  KYS +V++   R  F+ ++++FL++Y FDGLD+DWEYPG S  G    D+QN++ 
Sbjct  108  GEGGRKYSHLVSDKKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFY 167
Query  179  LVRELKEAF--EPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVF 236
            +V EL+ AF  E  G+ +T AV     +++  Y + +L +L D ++VM YD  G W    
Sbjct  168  FVEELRRAFDKEGKGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFA 227
Query  237  GHNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVK- 295
              ++PLY+RP+E    +  +N N  M+ +++ G + DKLV+G PFYGR +++   +  K 
Sbjct  228  DVHSPLYQRPNE-GYGYQALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKD 286
Query  296  LG---DPAKGMSPPGFITGEEGVLSYIELCQLFQ--KEEWHIQYDEYYNAPYGYND-KIW 349
            +G   +   G    G  TG +G+L+Y E+C ++Q    +W  ++D+    PY Y+D   W
Sbjct  287  IGTYINKDAGGGDAGPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQW 346
Query  350  VGYDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSY 409
            VGYD+  S+  K+ F+KE G  G M W+++ DDF G CG K PL+N +        KN  
Sbjct  347  VGYDNEISLQYKMDFIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVL-------AKNMK 399
Query  410  ECLLGPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPST 469
            + ++ P  T    TTP  P    P  TT    S TT T TT +  +T   T TT +T ST
Sbjct  400  DYVV-P--TLQISTTPR-PEWDRPKSTTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTST 455
Query  470  TTPTPTTPSTTSTTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCE 529
              PT TTPS      P+ TTTD+T+  P  T         C      P   N ++Y +C 
Sbjct  456  IDPTITTPSFP----PSETTTDATTGGPTVTP-------SCANANFYP-AANCNQYYMC- 502
Query  530  YVNGGWWVHIMPCPPGTIWCQEKLTC 555
              N G  + +M CP GT+W QE + C
Sbjct  503  --NQGTPI-LMTCPSGTVWVQEGIRC 525

Sequence Alignment: 6. Allergen Name: Der f 18.0101 Sequence ID: AAM19082

 Score = 79.0 bits 319,  Expect = 7e-16
 Identities = 132/385 34%, Positives = 209/385 54%, Gaps = 57/385 14%
Query  2    KTSCAIL-ILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYH----KVDPYTIEDI 56
            + S  +L +L ACFG   + ++   N  +  P + VCY  +W  +     K+DP   EDI
Sbjct  3    RFSLTVLAVLAACFG---SNIR--PNVATLEP-KTVCYYESWVHWRQGEGKMDP---EDI 53
Query  57   DPFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISL 116
            D   CTH++Y +  ID   + I+++D Y        + H  E F   +        MI++
Sbjct  54   DTSLCTHIVYSYFGIDAATHEIKLLDEYL-----MKDLHDMEHFTQHK---GNAKAMIAV 105
Query  117  GGWYEGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNY 176
            GG    S+++S   A   YR+ FV S +D++  Y FDG+ +DW       G    D  N+
Sbjct  106  GG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDWS------GMQAKDSDNF 158
Query  177  LTLVRELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVF 236
            + L+ ++ E F    +++   +       D  Y +  ++   D+MNV++ DY G W +  
Sbjct  159  IKLLDKFDEKFAHTSFVMGVTLPATIASYD-NYNIPAISNYVDFMNVLSLDYTGSWAHTV 217
Query  237  GHNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKL 296
            GH +P+   P++   L  Y       H     GA R K+VM VPFY R W +E  +K  +
Sbjct  218  GHASPF---PEQLKTLEAY-------H---KRGAPRHKMVMAVPFYARTWILEKMNKQDI 264
Query  297  GDPAKGMSPPGFITGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIWV 350
            GD A G  P G  T  +G LSY ELC   Q E   + I  D    A Y      N   W+
Sbjct  265  GDKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTITRDHDNTAIYAVYVHSNHAEWI 324
Query  351  GYDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYE 410
             ++D  ++  K   + + G +G+ +++L N+D  G CG K PLL+ +       + N Y 
Sbjct  325  SFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGDKNPLLHAI-------QSNYYH 377
Query  411  CLLG-PSTTTPTPTTPSTPSTT 431
             ++  P+  T  P T +T   T
Sbjct  378  GVVTEPTVVTLPPVTHTTEHVT 399

Sequence Alignment: 7. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 78.7 bits 318,  Expect = 8e-16
 Identities = 129/386 33%, Positives = 204/386 52%, Gaps = 55/386 14%
Query  2    KTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYH----KVDPYTIEDID 57
            + S  +LI++A +    + ++   N  + +P + VCY  +W  +     K+DP   EDID
Sbjct  3    RLSFTVLIFLAAY--FGSNIR--PNVATLDP-KTVCYYESWVHWRQGDGKMDP---EDID 54
Query  58   PFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLG 117
               C+H++Y +  ID   + I+++D Y          H  E F   +        MI++G
Sbjct  55   TSLCSHIVYSYFGIDASSHEIKLLDQYL-----MITLHDMEHFTKHK---GNAKAMIAVG 106
Query  118  GWYEGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL 177
            G    S+++S   A   YR+ FV S +D++ +Y FDG+ +DW       G    D  N++
Sbjct  107  G-ASMSDQFSKTAAVEHYRETFVVSTIDLMTKYGFDGVMIDWS------GMQAKDSDNFV 159
Query  178  TLVRELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFG 237
             L+ ++ E F    +++   +       D  Y +  ++   D+MNV+T DY G W    G
Sbjct  160  KLLDKFDEKFAQTSFVMGVTLPATIASYD-NYNIPAISNYVDFMNVLTLDYDGPWAYTVG 218
Query  238  HNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLG 297
            H + L   P++            T+  Y   GA R K+VM VPF+ R W +E   K  +G
Sbjct  219  HASAL---PEQLK----------TLEAYNKRGAPRHKMVMAVPFFARTWILEKMDKQDVG 265
Query  298  DPAKGMSPPGFITGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIWVG 351
            D A G  P G  T   G LSY ELC   Q E   + I  D    A Y      N   W+ 
Sbjct  266  DKASGPGPKGQFTQTPGFLSYNELCVQIQAETNAFSITRDHDNTAIYAVYVHDNHAEWIS 325
Query  352  YDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVH-NMINGDEKNSYE 410
            ++D  ++  K   + E G  G+ +++L N+D  G CG K PLL+ ++ N   G       
Sbjct  326  FEDRHTLGDKARNITEQGYGGMSVYTLSNEDVHGVCGDKNPLLHAINSNYFRG------- 378
Query  411  CLLGPSTTTPTPTTPSTPSTT 431
             +  P+  T TP T +T   T
Sbjct  379  IVTEPTVVTVTPVTHTTEHVT 399

Sequence Alignment: 8. Allergen Name: Der f 23.0101 Sequence ID: ALU66112

 Score = 54.8 bits 211,  Expect = 5e-09
 Identities = 56/142 39%, Positives = 80/142 56%, Gaps = 23/142 16%
Query  399  NMINGDEKNSYECLLG--PSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTT--PSTP 454
            +  + D++NS        P+T     TT   PS+    PTT  + ST  PT TT  PS P
Sbjct  24   DHFDNDDQNSSTSRPDDDPTTMIDVQTTTVQPSSM---PTTSESESTVKPTTTTVKPS-P 79
Query  455  STTTPTPTTPSTPSTTT-PTPTT-PSTTSTTTPTPTTTDSTS-ETPKYTTYVDGHLIKC- 510
            +T  PT TT    +TT  P+PTT   TT+T  P+PTTT +T+ E P+          +C 
Sbjct  80   TTVKPTTTTVKLTTTTVKPSPTTVKPTTTTVKPSPTTTTTTTTEQPE-------DEFECP 132
Query  511  YKEGDLPHPTNIHKYLVCEYVNGGWWVHIMPCPPGTIWCQEKLTC 555
             + G +  P +  K+ +C      W      CP  T W +++LTC
Sbjct  133  TRFGYFADPKDPCKFYIC----SNWEAIHKSCPGNTRWNEKELTC 173

Sequence Alignment: 9. Allergen Name: Blo t 12 Sequence ID: Q17282

 Score = 39.3 bits 142,  Expect = 0.0002
 Identities = 31/106 29%, Positives = 49/106 46%, Gaps = 8/106 7%
Query  452  STPSTTTPTPTTPSTPSTTTPTPTTPSTTSTT-TP---TPTTTDSTSETPKYTTYVDG-- 505
            + P      PTT  T   TT T        TT TP     TTT+ T  +     +  G  
Sbjct  31   TEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKT 90
Query  506  -HLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIMPCPPGTIWCQEKLTCITE 558
             H++ C++EG +      +KY++C      W++ +MPC  GT +      C+ +
Sbjct  91   YHVV-CHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISRNCVLD 143

Sequence Alignment: 10. Allergen Name: Asp f 16 Sequence ID: AAC61261

 Score = 35.2 bits 127,  Expect = 0.01
 Identities = 21/61 34%, Positives = 39/61 63%, Gaps = 2/61 3%
Query  436  TTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTP--TTPSTTSTTTPTPTTTDST 493
            ++ S  S+TT T ++ S+ S+ TP+ +T +T +  TPTP  T+  + S+++  PTTT  +
Sbjct  272  SSSSVTSSTTSTASSASSTSSKTPSTSTLATSTKATPTPSGTSSGSNSSSSAEPTTTGGS 331
Query  494  SET 496
              +
Sbjct  332  GSS 334

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.