The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA
AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sequence Info Allergen Name Length Opt Bits Score E Value
BAF75705 Ani s 8.0101 150 953 218.1 8e-59
BAF75703 Ani s 8.0101 150 936 214.4 1.1e-57
BAF75704 Ani s 8.0101 150 933 213.7 1.7e-57
BAF75708 Ani s 8.0101 150 933 213.7 1.7e-57
BAF75707 Ani s 8.0101 150 932 213.5 2e-57
BAF75712 Ani s 8.0101 150 931 213.3 2.3e-57
BAF75706 Ani s 8.0101 150 930 213.0 2.7e-57
BAF75710 Ani s 8.0101 150 930 213.0 2.7e-57
BAF75711 Ani s 8.0101 150 928 212.6 3.7e-57
BAF75709 Ani s 8.0101 150 925 211.9 5.8e-57
AB274998 Ani s 5.0101 152 271 67.9 1.4e-13
ABV55106 Ani s 9.0101 147 268 67.2 2.1e-13
QGS84239 Asc l 5.0101 150 267 67.0 2.5e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ani s 8.0101 Sequence ID: BAF75705

 Score = 218.1 bits 953,  Expect = 8e-59
 Identities = 150/150 100%, Positives = 150/150 100%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 2. Allergen Name: Ani s 8.0101 Sequence ID: BAF75703

 Score = 214.4 bits 936,  Expect = 1e-57
 Identities = 148/150 98%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 3. Allergen Name: Ani s 8.0101 Sequence ID: BAF75704

 Score = 213.7 bits 933,  Expect = 2e-57
 Identities = 147/150 98%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            M+VLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MRVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 4. Allergen Name: Ani s 8.0101 Sequence ID: BAF75708

 Score = 213.7 bits 933,  Expect = 2e-57
 Identities = 147/150 98%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTF+DDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFRDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 5. Allergen Name: Ani s 8.0101 Sequence ID: BAF75707

 Score = 213.5 bits 932,  Expect = 2e-57
 Identities = 147/150 98%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDA+AALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAYAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 6. Allergen Name: Ani s 8.0101 Sequence ID: BAF75712

 Score = 213.3 bits 931,  Expect = 2e-57
 Identities = 147/150 98%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEEL+KLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELDKLNQQGQS 150

Sequence Alignment: 7. Allergen Name: Ani s 8.0101 Sequence ID: BAF75706

 Score = 213.0 bits 930,  Expect = 3e-57
 Identities = 147/150 98%, Positives = 147/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA  LAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVPLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 8. Allergen Name: Ani s 8.0101 Sequence ID: BAF75710

 Score = 213.0 bits 930,  Expect = 3e-57
 Identities = 147/150 98%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVN+HPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTAIADDASLTLA
Sbjct  61   FVNNHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 9. Allergen Name: Ani s 8.0101 Sequence ID: BAF75711

 Score = 212.6 bits 928,  Expect = 4e-57
 Identities = 147/150 98%, Positives = 147/150 98%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            FVNDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAE TAIADDASLTLA
Sbjct  61   FVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAESTAIADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 10. Allergen Name: Ani s 8.0101 Sequence ID: BAF75709

 Score = 211.9 bits 925,  Expect = 6e-57
 Identities = 146/150 97%, Positives = 146/150 97%, Gaps = 0/150 0%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            MKVLFFVAAVVA SLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ
Sbjct  1    MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
Query  61   FVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLA 120
            F NDHPAIKDAYEAEKKEVLAAQQA EEEHKKLVAALPPDAQKADAELTA ADDASLTLA
Sbjct  61   FANDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTATADDASLTLA 120
Query  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150
            AKHDKIVQTFESLPPAVKEELNKLNQQGQS
Sbjct  121  AKHDKIVQTFESLPPAVKEELNKLNQQGQS 150

Sequence Alignment: 11. Allergen Name: Ani s 5.0101 Sequence ID: AB274998

 Score = 67.9 bits 271,  Expect = 1e-13
 Identities = 54/142 38%, Positives = 78/142 54%, Gaps = 3/142 2%
Query  1    MKVLFFVAAVVADSLA-QDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQ 59
            MK L   A      +A  D  PPP P FL GA Q    AF  L +  +  TD ++E  + 
Sbjct  1    MKTLIVAALFCTIGMALADDTPPP-PPFLAGAPQDVVKAFFELLKKDETKTDPEIEKDLD 59
Query  60   QFVNDHPA-IKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLT 118
             +V+      K  +E  KKE+ A +    + H++ VA + P+A+KADAEL+ IA+D SL 
Sbjct  60   AWVDTLGGDYKAKFETFKKEMKAKEAELAKAHEEAVAKMTPEAKKADAELSKIAEDDSLN 119
Query  119  LAAKHDKIVQTFESLPPAVKEELNK 143
               K  KI   +++LP +VK+EL K
Sbjct  120  GIQKAQKIQAIYKTLPQSVKDELEK 144

Sequence Alignment: 12. Allergen Name: Ani s 9.0101 Sequence ID: ABV55106

 Score = 67.2 bits 268,  Expect = 2e-13
 Identities = 51/141 36%, Positives = 78/141 55%, Gaps = 8/141 5%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQ 60
            + V  FV AV A      QGPPPLP F+  A  A +  F  LA    D T+ ++E  ++Q
Sbjct  6    LAVAVFVVAVSA------QGPPPLPPFVANAPPAVQAEFRQLANGAPDKTEAEIEAQIEQ 59
Query  61   FVNDHP-AIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTL 119
            +V     A++  +   K+ +   +   E  H+  +  L P A+ ADA L+AIA + +L +
Sbjct  60   WVASKGGAVQAEFNKFKQMLEQGKARAEAAHQASLTRLSPAAKAADARLSAIASNRALKV 119
Query  120  AAKHDKIVQTFESLPPAVKEELNKLNQQG 148
              K+ ++   F++L PAVK EL K   QG
Sbjct  120  GEKQRQLAAAFQALDPAVKAELQK-EMQG 147

Sequence Alignment: 13. Allergen Name: Asc l 5.0101 Sequence ID: QGS84239

 Score = 67.0 bits 267,  Expect = 3e-13
 Identities = 55/142 38%, Positives = 80/142 56%, Gaps = 3/142 2%
Query  1    MKVLFFVAAVVADSLAQDQGPPPLPKFLDGA-DQATKDAFAALAQTFKDDTDKQVEDAVQ 59
            MK L  V  +   +L + Q P  +P FL GA + A KD F  L +  ++ TD ++E  + 
Sbjct  1    MKYLITVTCLFVLALVEGQTPSRVPPFLVGAPESAVKDFFE-LIKKDEEKTDPEIEADID 59
Query  60   QFVNDHPA-IKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLT 118
             FV    A   + + A K E+ A +   E+ H   +A + P A++ADA+LTAIA+DA L 
Sbjct  60   AFVAKLGADYTNKFIAFKAELKAHEAEYEKAHAAAIAKFSPAAKEADAKLTAIAEDAKLN 119
Query  119  LAAKHDKIVQTFESLPPAVKEELNK 143
               K  KI +T ESLP  V++EL K
Sbjct  120  GIQKRQKIKETMESLPKEVRDELEK 144

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.