The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF
EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP
DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY
YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV
ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK
ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR
RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE
KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV
LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL
PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV
AAAQAALV
Sequence Info Allergen Name Length Opt Bits Score E Value
P49822 Can f 3 608 4138 949.4 0
P49064 Fel d 2 608 3702 850.0 0
P08835 Sus s 1.0101 607 3379 776.4 0
CAA52194 Equ c 3 607 3349 769.6 0
CAA41735 Bos d 6 607 3349 769.6 0
P02769 Bos d 6 607 3348 769.3 0
Q6WDN9 Cav p 4.0101 608 3271 751.8 3e-218
CAA43098 Gal d 5 615 2163 499.2 3.2e-142
AAB30434 Can f 3 265 1777 411.5 3.5e-116
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Can f 3 Sequence ID: P49822

 Score = 949.4 bits 4138,  Expect = 0
 Identities = 608/608 100%, Positives = 608/608 100%, Gaps = 0/608 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF
Sbjct  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP
Sbjct  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY
Sbjct  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV
Sbjct  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK
Sbjct  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR
Sbjct  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE
Sbjct  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV
Sbjct  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL
Sbjct  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV
Sbjct  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
Query  601  AAAQAALV 608
            AAAQAALV
Sbjct  601  AAAQAALV 608

Sequence Alignment: 2. Allergen Name: Fel d 2 Sequence ID: P49064

 Score = 850.0 bits 3702,  Expect = 0
 Identities = 528/607 86%, Positives = 577/607 95%, Gaps = 0/607 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISL++LFSSAYSRG+ RREA++SEIAHR+NDLGEEHFRGLVLVAFSQYLQQCPF
Sbjct  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            EDHVKL  EVTEFAK C A++S ANC+KSLH L+GDKLCTVASLRDKYG+MADCCEK+EP
Sbjct  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            +RNECFL HKDDNPGF  LV PE DA+C AF++NEQ FLGKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            YA++YKGVF ECC+AADKAACL PK++ALREKVL SSAKER+KCASLQKFG+RAFKAWSV
Sbjct  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQ+FPKA+FAEISK+VTDL K+HKECCHGDLLECADDRADLAKY+CENQDSISTKLK
Sbjct  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KPVLEKS+C++EVERDELP DLP LA DFVEDKEVCKNYQEAKDVFLGTFLYEYSR
Sbjct  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHPEYSVSLLLRLAKEYEATLEKCCATDDPP CYA V+DEFKPLV+EP+NLVKTNCELFE
Sbjct  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            KLGEYGFQNALLVRYTKK PQVSTPTLVEVSR LGKVG+KCC  PE+ER+SCA+D+LSVV
Sbjct  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLCVLHEKTPVSERVTKCC+ESLVNRRPCFS L+VDETYVPKEF+AETFTFHADLCTL
Sbjct  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            PEAEKQ+KKQ+ALVELLKHKPKAT+EQLKTVMGDFG+FV+KCCAAE+KE CF+EEGPKLV
Sbjct  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
Query  601  AAAQAAL 607
            AAAQAAL
Sbjct  601  AAAQAAL 607

Sequence Alignment: 3. Allergen Name: Sus s 1.0101 Sequence ID: P08835

 Score = 776.4 bits 3379,  Expect = 0
 Identities = 476/606 78%, Positives = 543/606 89%, Gaps = 1/606 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISL+FLFSSAYSRG+ RR+ YKSEIAHR+ DLGE++F+GLVL+AFSQ+LQQCP+
Sbjct  1    MKWVTFISLLFLFSSAYSRGVFRRDTYKSEIAHRFKDLGEQYFKGLVLIAFSQHLQQCPY 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            E+HVKL +EVTEFAK C A+ES  NCDKS+HTLFGDKLC + SLR+ YGD+ADCCEK+EP
Sbjct  61   EEHVKLVREVTEFAKTCVADESAENCDKSIHTLFGDKLCAIPSLREHYGDLADCCEKEEP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            +RNECFL HK+DNP  P L  P+P ALCA FQ++EQ F GKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLQHKNDNPDIPKL-KPDPVALCADFQEDEQKFWGKYLYEIARRHPYFYAPELLY 179
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            YA  YK VF+ECCQAADKAACL PKIE LREKVL S+AK+R+KCAS+QKFG+RAFKAWS+
Sbjct  180  YAIIYKDVFSECCQAADKAACLLPKIEHLREKVLTSAAKQRLKCASIQKFGERAFKAWSL 239
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQRFPKADF EISK+VTDL KVHKECCHGDLLECADDRADLAKY+CENQD+ISTKLK
Sbjct  240  ARLSQRFPKADFTEISKIVTDLAKVHKECCHGDLLECADDRADLAKYICENQDTISTKLK 299
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECCDKP+LEKS+C+AE +RDELP DL  L  DFVEDKEVCKNY+EAK VFLGTFLYEYSR
Sbjct  300  ECCDKPLLEKSHCIAEAKRDELPADLNPLEHDFVEDKEVCKNYKEAKHVFLGTFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHP+YSVSLLLR+AK YEATLE CCA +DPP CYA V+D+F+PLVDEP+NL+K NCELFE
Sbjct  360  RHPDYSVSLLLRIAKIYEATLEDCCAKEDPPACYATVFDKFQPLVDEPKNLIKQNCELFE 419
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            KLGEYGFQNAL+VRYTKK PQVSTPTLVEV+RKLG VG++CCK+PE ER+SCA+D+LS+V
Sbjct  420  KLGEYGFQNALIVRYTKKVPQVSTPTLVEVARKLGLVGSRCCKRPEEERLSCAEDYLSLV 479
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE+VTKCC+ESLVNRRPCFS L  DETY PKEF   TFTFHADLCTL
Sbjct  480  LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYKPKEFVEGTFTFHADLCTL 539
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            PE EKQ+KKQTALVELLKHKP AT+EQL+TV+G+F AFV+KCCAA + E CF+ EGPK+V
Sbjct  540  PEDEKQIKKQTALVELLKHKPHATEEQLRTVLGNFAAFVQKCCAAPDHEACFAVEGPKFV 599
Query  601  AAAQAAL 607
               +  L
Sbjct  600  IEIRGIL 606

Sequence Alignment: 4. Allergen Name: Equ c 3 Sequence ID: CAA52194

 Score = 769.6 bits 3349,  Expect = 0
 Identities = 463/606 76%, Positives = 546/606 90%, Gaps = 1/606 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTF+SL+FLFSSAYSRG++RR+ +KSEIAHR+NDLGE+HF+GLVLVAFSQYLQQCPF
Sbjct  1    MKWVTFVSLLFLFSSAYSRGVLRRDTHKSEIAHRFNDLGEKHFKGLVLVAFSQYLQQCPF 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            EDHVKL  EVTEFAK CAA+ES  NCDKSLHTLFGDKLCTVA+LR  YG++ADCCEKQEP
Sbjct  61   EDHVKLVNEVTEFAKKCAADESAENCDKSLHTLFGDKLCTVATLRATYGELADCCEKQEP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            +RNECFL HKDD+P +P L  PEPDA CAAFQ++   FLGKYLYE+ARRHPYFY PELL+
Sbjct  121  ERNECFLTHKDDHPNLPKL-KPEPDAQCAAFQEDPDKFLGKYLYEVARRHPYFYGPELLF 179
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            +A++YK  F ECC A DK ACL PK++AL+E++LLSSAKER+KC+S+Q FG+RA KAWSV
Sbjct  180  HAEEYKADFTECCPADDKLACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVKAWSV 239
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQ+FPKADFAE+SK+VTDLTKVHKECCHGDLLECADDRADLAKY+CE+QDSIS KLK
Sbjct  240  ARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDLLECADDRADLAKYICEHQDSISGKLK 299
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
             CCDKP+L+KS+C+AEV+ D+LP DLP+LAADF EDKE+CK+Y++AKDVFLGTFLYEYSR
Sbjct  300  ACCDKPLLQKSHCIAEVKEDDLPSDLPALAADFAEDKEICKHYKDAKDVFLGTFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHP+YSVSLLLR+AK YEATLEKCCA  DPP CY  V+D+F PLV+EP++LVK NC+LFE
Sbjct  360  RHPDYSVSLLLRIAKTYEATLEKCCAEADPPACYRTVFDQFTPLVEEPKSLVKKNCDLFE 419
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            ++GEY FQNAL+VRYTKKAPQVSTPTLVE+ R LGKVG++CCK PESER+ C+++ L++ 
Sbjct  420  EVGEYDFQNALIVRYTKKAPQVSTPTLVEIGRTLGKVGSRCCKLPESERLPCSENHLALA 479
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE++TKCC++SL  RRPCFS LE+DE YVPKEF AETFTFHAD+CTL
Sbjct  480  LNRLCVLHEKTPVSEKITKCCTDSLAERRPCFSALELDEGYVPKEFKAETFTFHADICTL 539
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            PE EKQ+KKQ+AL EL+KHKPKAT EQLKTV+G+F AFV KCC  E+KE CF+EEGPKLV
Sbjct  540  PEDEKQIKKQSALAELVKHKPKATKEQLKTVLGNFSAFVAKCCGREDKEACFAEEGPKLV 599
Query  601  AAAQAAL 607
            A++Q AL
Sbjct  600  ASSQLAL 606

Sequence Alignment: 5. Allergen Name: Bos d 6 Sequence ID: CAA41735

 Score = 769.6 bits 3349,  Expect = 0
 Identities = 465/606 76%, Positives = 545/606 89%, Gaps = 1/606 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISL++LFSSAYSRG+ RR+ +KSEIAHR+ DLGEEHF+GLVL+AFSQYLQQCPF
Sbjct  1    MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            ++HVKL  E+TEFAK C A+ES A C+KSLHTLFGD+LC VASLR+ YGDMADCCEKQEP
Sbjct  61   DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            +RNECFL+HKDD+P +P L  P+P+ LC  F+ +E+ F GKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY 179
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            YA +Y GVF ECCQA DK ACL PKIE +REKVL SSA++R++CAS+QKFG+RA+KAWSV
Sbjct  180  YANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSV 239
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQ+FPKA+F E++K+VTDLTKVHKECCHGDLLECADDRADLAKY+C+NQD+IS+KLK
Sbjct  240  ARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLK 299
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECCDKP+LEKS+C+AEVE+D +P +LP L ADF EDK+VCKNYQEAKD FLG+FLYEYSR
Sbjct  300  ECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHPEY+VS+LLRLAKEYEATLE+CCA DDP  CY+ V+D++K LVDEPQNL+K NC+ FE
Sbjct  360  RHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFE 419
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            KLGEYGFQNAL+VRYT+K PQVSTPTLVEVSR LGKVGT+CC KPESERM C +D+LS++
Sbjct  420  KLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLI 479
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE+VTKCC+ESLVNRRPCFS L  DETYVPK F+ + FTFHAD+CTL
Sbjct  480  LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTL 539
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            P+ EKQ+KKQTALVELLKHKPKAT+EQLKTVM +F AFV+KCCAA++KE CF+ EGPKLV
Sbjct  540  PDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLV 599
Query  601  AAAQAAL 607
             + Q AL
Sbjct  600  VSTQTAL 606

Sequence Alignment: 6. Allergen Name: Bos d 6 Sequence ID: P02769

 Score = 769.3 bits 3348,  Expect = 0
 Identities = 465/606 76%, Positives = 545/606 89%, Gaps = 1/606 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISL++LFSSAYSRG+ RR+ +KSEIAHR+ DLGEEHF+GLVL+AFSQYLQQCPF
Sbjct  1    MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            ++HVKL  E+TEFAK C A+ES A C+KSLHTLFGD+LC VASLR+ YGDMADCCEKQEP
Sbjct  61   DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            +RNECFL+HKDD+P +P L  P+P+ LC  F+ +E+ F GKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY 179
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            YA +Y GVF ECCQA DK ACL PKIE +REKVL SSA++R++CAS+QKFG+RA+KAWSV
Sbjct  180  YANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSV 239
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQ+FPKA+F E++K+VTDLTKVHKECCHGDLLECADDRADLAKY+C+NQD+IS+KLK
Sbjct  240  ARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLK 299
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECCDKP+LEKS+C+AEVE+D +P +LP L ADF EDK+VCKNYQEAKD FLG+FLYEYSR
Sbjct  300  ECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHPEY+VS+LLRLAKEYEATLE+CCA DDP  CY+ V+D++K LVDEPQNL+K NC+ FE
Sbjct  360  RHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFE 419
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            KLGEYGFQNAL+VRYT+K PQVSTPTLVEVSR LGKVGT+CC KPESERM C +D+LS++
Sbjct  420  KLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLI 479
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE+VTKCC+ESLVNRRPCFS L  DETYVPK F+ + FTFHAD+CTL
Sbjct  480  LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTL 539
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            P+ EKQ+KKQTALVELLKHKPKAT+EQLKTVM +F AFV+KCCAA++KE CF+ EGPKLV
Sbjct  540  PDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLV 599
Query  601  AAAQAAL 607
             + Q AL
Sbjct  600  VSTQTAL 606

Sequence Alignment: 7. Allergen Name: Cav p 4.0101 Sequence ID: Q6WDN9

 Score = 751.8 bits 3271,  Expect = 3e-218
 Identities = 448/607 73%, Positives = 539/607 88%, Gaps = 0/607 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISL+FLFSS YSRG+ RREA+KSEIAHR+NDLGE HF+GLVL+ +SQ+LQ+ PF
Sbjct  1    MKWVTFISLLFLFSSVYSRGVFRREAHKSEIAHRFNDLGEGHFKGLVLITLSQHLQKSPF 60
Query  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
            E+HVKL  EVT+FAKAC A+ES  NC K++ TLFGDK+C + SLR+ YG++ADCC K++P
Sbjct  61   EEHVKLVNEVTDFAKACVADESAQNCGKAIATLFGDKVCAIPSLRETYGELADCCAKEDP 120
Query  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
            DR ECFL HKDDNP +PP+  PEP+ALC AF++N   F+G YLYE++RRHPYFYAPELLY
Sbjct  121  DRVECFLQHKDDNPNLPPFERPEPEALCTAFKENNDRFIGHYLYEVSRRHPYFYAPELLY 180
Query  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
            YA++YK  + ECC+AADKAACL PK++A++EK L+SSA++R+KCASLQKFG+RAFKAWSV
Sbjct  181  YAEKYKNALTECCEAADKAACLTPKLDAIKEKALVSSAQQRLKCASLQKFGERAFKAWSV 240
Query  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
            ARLSQ+FPKA+FAEIS +VT LTKV KECCHGDLLECADDR +LAKYMCE+QDSIS+KLK
Sbjct  241  ARLSQKFPKAEFAEISTIVTSLTKVTKECCHGDLLECADDRQELAKYMCEHQDSISSKLK 300
Query  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KP L+K++C+ E++RDELP +LP LA DFVEDKEVCKN+ EAKDVFLGTFLYEYSR
Sbjct  301  ECCVKPTLQKAHCILEIQRDELPTELPDLAVDFVEDKEVCKNFAEAKDVFLGTFLYEYSR 360
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
            RHPEYS+ +LLR+AK YEA LEKCCA  DP  CYAKV+DE++PL+DEP+ LV+ NCELF+
Sbjct  361  RHPEYSIGMLLRIAKGYEAKLEKCCAEADPHACYAKVFDELQPLIDEPKKLVQQNCELFD 420
Query  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
            KLGEYGFQNAL VRYT+KAPQVSTPTLVE +RKLG VGTKCC  PE+ER+SC +++L+++
Sbjct  421  KLGEYGFQNALAVRYTQKAPQVSTPTLVEYARKLGSVGTKCCSLPETERLSCTENYLALI 480
Query  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
            LNRLC+LHEKTPVSERVTKCC+ESLVNRRPCFS L VDETYVPK F+A++FTFHAD+CTL
Sbjct  481  LNRLCILHEKTPVSERVTKCCTESLVNRRPCFSALHVDETYVPKPFHADSFTFHADICTL 540
Query  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
            PE EKQVKKQ ALVEL+KHKPKA++EQ+KTVMGDF AF++KCC A+NKE CF+E+GPKLV
Sbjct  541  PEKEKQVKKQMALVELVKHKPKASEEQMKTVMGDFAAFLKKCCDADNKEACFTEDGPKLV 600
Query  601  AAAQAAL 607
            A  QA L
Sbjct  601  AKCQATL 607

Sequence Alignment: 8. Allergen Name: Gal d 5 Sequence ID: CAA43098

 Score = 499.2 bits 2163,  Expect = 3e-142
 Identities = 290/607 47%, Positives = 412/607 67%, Gaps = 4/607 0%
Query  1    MKWVTFISLFFLFSSAYSRGLVR--REA-YKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQ 57
            MKWVT+IS+ FLFSSA SR L R  R+A +KSEIAHRYNDL EE F+ + ++ F+QYLQ+
Sbjct  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
Query  58   CPFEDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEK 117
            C +E   KL K+V ++A+ C A E    C K L ++  D++C V  LRD YG MADCC K
Sbjct  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
Query  118  QEPDRNECFLAHKDDNPGF-PPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAP 176
             +P+RNECFL+ K   P F  P   P  D +C  +QDN   FLG ++Y +ARRHP++YAP
Sbjct  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
Query  177  ELLYYAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFK 236
             +L +A  ++  +  CC+ +D  ACL  K   +REK    S K+++ C  L++FGDR F+
Sbjct  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
Query  237  AWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSIS 296
            A  +  LSQ++PKA F+E+SK V D   VHKECC GD++EC DD A +   +C  QD  S
Sbjct  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
Query  297  TKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLY 356
             K+K+CC+KP++E+SQC+ E E DE P DLPSL   ++EDKEVCK+++   D F+  F+Y
Sbjct  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
Query  357  EYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNC 416
            EYSRRHPE+S+ L++R+AK YE+ LEKCC TD+P  CYA   +++   + E Q++VKTNC
Sbjct  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
Query  417  ELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDF 476
            +L+   GE  F  ++L+RYTKK PQV T  L+E  +K+  +GTKCC+  E  RM+C++ +
Sbjct  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
Query  477  LSVVLNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHAD 536
            LS+V++  C  +E TP+++ V++CCS+   NRRPCF+ + VD  YVP  FN + F+F   
Sbjct  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
Query  537  LCTLPEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEG 596
            LC+ P  E++V +   L+ L+K KP+ T+EQ+KT+   F A V+KCC   +   CF EEG
Sbjct  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
Query  597  PKLVAAAQAAL 607
              L+  ++A L
Sbjct  601  ANLIVQSRATL 611

Sequence Alignment: 9. Allergen Name: Can f 3 Sequence ID: AAB30434

 Score = 411.5 bits 1777,  Expect = 4e-116
 Identities = 264/264 100%, Positives = 264/264 100%, Gaps = 1/264 0%
Query  215  LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 274
            LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL
Sbjct  1    LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 60
Query  275  LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 334
            LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV
Sbjct  61   LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 120
Query  335  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 394
            EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY
Sbjct  121  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 180
Query  395  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLV-EVSRK 453
            AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLV EVSRK
Sbjct  181  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK 240
Query  454  LGKVGTKCCKKPESERMSCADDFLS 478
            LGKVGTKCCKKPESERMSCADDFLS
Sbjct  241  LGKVGTKCCKKPESERMSCADDFLS 265

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.