The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF
EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP
ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY
YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV
ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK
ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR
RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE
KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV
LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL
PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV
AAAQAALA
Sequence Info Allergen Name Length Opt Bits Score E Value
P49064 Fel d 2 608 4118 944.9 0
P49822 Can f 3 608 3702 850.0 0
P02769 Bos d 6 607 3409 783.2 0
CAA41735 Bos d 6 607 3404 782.1 0
P08835 Sus s 1.0101 607 3386 778.0 0
CAA52194 Equ c 3 607 3377 775.9 0
Q6WDN9 Cav p 4.0101 608 3312 761.1 0
CAA43098 Gal d 5 615 2135 492.8 2.7e-140
AAB30434 Can f 3 265 1621 375.9 1.8e-105
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fel d 2 Sequence ID: P49064

 Score = 944.9 bits 4118,  Expect = 0
 Identities = 608/608 100%, Positives = 608/608 100%, Gaps = 0/608 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF
Sbjct  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP
Sbjct  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV
Sbjct  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK
Sbjct  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR
Sbjct  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE
Sbjct  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV
Sbjct  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL
Sbjct  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV
Sbjct  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
Query  601  AAAQAALA 608
            AAAQAALA
Sbjct  601  AAAQAALA 608

Sequence Alignment: 2. Allergen Name: Can f 3 Sequence ID: P49822

 Score = 850.0 bits 3702,  Expect = 0
 Identities = 528/607 86%, Positives = 577/607 95%, Gaps = 0/607 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISL++LFSSAYSRG+ RREA++SEIAHR+NDLGEEHFRGLVLVAFSQYLQQCPF
Sbjct  1    MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            EDHVKL  EVTEFAK C A++S ANC+KSLH L+GDKLCTVASLRDKYG+MADCCEK+EP
Sbjct  61   EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            +RNECFL HKDDNPGF  LV PE DA+C AF++NEQ FLGKYLYEIARRHPYFYAPELLY
Sbjct  121  DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY 180
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            YA++YKGVF ECC+AADKAACL PK++ALREKVL SSAKER+KCASLQKFG+RAFKAWSV
Sbjct  181  YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV 240
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQ+FPKA+FAEISK+VTDL K+HKECCHGDLLECADDRADLAKY+CENQDSISTKLK
Sbjct  241  ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK 300
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KPVLEKS+C++EVERDELP DLP LA DFVEDKEVCKNYQEAKDVFLGTFLYEYSR
Sbjct  301  ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHPEYSVSLLLRLAKEYEATLEKCCATDDPP CYA V+DEFKPLV+EP+NLVKTNCELFE
Sbjct  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE 420
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            KLGEYGFQNALLVRYTKK PQVSTPTLVEVSR LGKVG+KCC  PE+ER+SCA+D+LSVV
Sbjct  421  KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV 480
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLCVLHEKTPVSERVTKCC+ESLVNRRPCFS L+VDETYVPKEF+AETFTFHADLCTL
Sbjct  481  LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL 540
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            PEAEKQ+KKQ+ALVELLKHKPKAT+EQLKTVMGDFG+FV+KCCAAE+KE CF+EEGPKLV
Sbjct  541  PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV 600
Query  601  AAAQAAL 607
            AAAQAAL
Sbjct  601  AAAQAAL 607

Sequence Alignment: 3. Allergen Name: Bos d 6 Sequence ID: P02769

 Score = 783.2 bits 3409,  Expect = 0
 Identities = 477/607 78%, Positives = 549/607 90%, Gaps = 1/607 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISLLLLFSSAYSRGV RR+ H+SEIAHRF DLGEEHF+GLVL+AFSQYLQQCPF
Sbjct  1    MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            ++HVKLVNE+TEFAK CVAD+S A CEKSLH L+GD+LC VASLR+ YG+MADCCEK+EP
Sbjct  61   DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            ERNECFL HKDD+P + +L  P+ + +C  F  +E++F GKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY 179
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            YA +Y GVF ECC+A DK ACL PK++ +REKVLASSA++RL+CAS+QKFGERA+KAWSV
Sbjct  180  YANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSV 239
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQKFPKAEF E++KLVTDL K+HKECCHGDLLECADDRADLAKYIC+NQD+IS+KLK
Sbjct  240  ARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLK 299
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KP+LEKSHCI+EVE+D +P +LPPL  DF EDK+VCKNYQEAKD FLG+FLYEYSR
Sbjct  300  ECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHPEY+VS+LLRLAKEYEATLE+CCA DDP ACY+ VFD++K LV+EP+NL+K NC+ FE
Sbjct  360  RHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFE 419
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            KLGEYGFQNAL+VRYT+KVPQVSTPTLVEVSRSLGKVG++CCT PE+ER+ C EDYLS++
Sbjct  420  KLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLI 479
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE+VTKCCTESLVNRRPCFSAL  DETYVPK F  + FTFHAD+CTL
Sbjct  480  LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTL 539
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            P+ EKQIKKQ+ALVELLKHKPKATEEQLKTVM +F +FVDKCCAA+DKEACFA EGPKLV
Sbjct  540  PDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLV 599
Query  601  AAAQAALA 608
             + Q ALA
Sbjct  600  VSTQTALA 607

Sequence Alignment: 4. Allergen Name: Bos d 6 Sequence ID: CAA41735

 Score = 782.1 bits 3404,  Expect = 0
 Identities = 476/607 78%, Positives = 548/607 90%, Gaps = 1/607 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISLLLLFSSAYSRGV RR+ H+SEIAHRF DLGEEHF+GLVL+AFSQYLQQCPF
Sbjct  1    MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            ++HVKLVNE+TEFAK CVAD+S A CEKSLH L+GD+LC VASLR+ YG+MADCCEK+EP
Sbjct  61   DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            ERNECFL HKDD+P + +L  P+ + +C  F  +E++F GKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLSHKDDSPDLPKL-KPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLY 179
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            YA +Y GVF ECC+A DK ACL PK++ +REKVL SSA++RL+CAS+QKFGERA+KAWSV
Sbjct  180  YANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSV 239
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQKFPKAEF E++KLVTDL K+HKECCHGDLLECADDRADLAKYIC+NQD+IS+KLK
Sbjct  240  ARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLK 299
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KP+LEKSHCI+EVE+D +P +LPPL  DF EDK+VCKNYQEAKD FLG+FLYEYSR
Sbjct  300  ECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHPEY+VS+LLRLAKEYEATLE+CCA DDP ACY+ VFD++K LV+EP+NL+K NC+ FE
Sbjct  360  RHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFE 419
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            KLGEYGFQNAL+VRYT+KVPQVSTPTLVEVSRSLGKVG++CCT PE+ER+ C EDYLS++
Sbjct  420  KLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLI 479
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE+VTKCCTESLVNRRPCFSAL  DETYVPK F  + FTFHAD+CTL
Sbjct  480  LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTL 539
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            P+ EKQIKKQ+ALVELLKHKPKATEEQLKTVM +F +FVDKCCAA+DKEACFA EGPKLV
Sbjct  540  PDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLV 599
Query  601  AAAQAALA 608
             + Q ALA
Sbjct  600  VSTQTALA 607

Sequence Alignment: 5. Allergen Name: Sus s 1.0101 Sequence ID: P08835

 Score = 778.0 bits 3386,  Expect = 0
 Identities = 483/607 79%, Positives = 546/607 89%, Gaps = 1/607 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISLL+LFSSAYSRGV RR+ ++SEIAHRF DLGE++F+GLVL+AFSQ+LQQCP+
Sbjct  1    MKWVTFISLLFLFSSAYSRGVFRRDTYKSEIAHRFKDLGEQYFKGLVLIAFSQHLQQCPY 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            E+HVKLV EVTEFAK CVAD+SA NC+KS+H L+GDKLC + SLR+ YG++ADCCEK+EP
Sbjct  61   EEHVKLVREVTEFAKTCVADESAENCDKSIHTLFGDKLCAIPSLREHYGDLADCCEKEEP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            ERNECFLQHK+DNP   +L  P+  A+C  F+E+EQ+F GKYLYEIARRHPYFYAPELLY
Sbjct  121  ERNECFLQHKNDNPDIPKL-KPDPVALCADFQEDEQKFWGKYLYEIARRHPYFYAPELLY 179
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            YA  YK VF+ECC+AADKAACL PK++ LREKVL S+AK+RLKCAS+QKFGERAFKAWS+
Sbjct  180  YAIIYKDVFSECCQAADKAACLLPKIEHLREKVLTSAAKQRLKCASIQKFGERAFKAWSL 239
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQ+FPKA+F EISK+VTDLAK+HKECCHGDLLECADDRADLAKYICENQD+ISTKLK
Sbjct  240  ARLSQRFPKADFTEISKIVTDLAKVHKECCHGDLLECADDRADLAKYICENQDTISTKLK 299
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KP+LEKSHCI+E +RDELPADL PL  DFVEDKEVCKNY+EAK VFLGTFLYEYSR
Sbjct  300  ECCDKPLLEKSHCIAEAKRDELPADLNPLEHDFVEDKEVCKNYKEAKHVFLGTFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHP+YSVSLLLR+AK YEATLE CCA +DPPACYA VFD+F+PLV+EP NL+K NCELFE
Sbjct  360  RHPDYSVSLLLRIAKIYEATLEDCCAKEDPPACYATVFDKFQPLVDEPKNLIKQNCELFE 419
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            KLGEYGFQNAL+VRYTKKVPQVSTPTLVEV+R LG VGS+CC  PE ERLSCAEDYLS+V
Sbjct  420  KLGEYGFQNALIVRYTKKVPQVSTPTLVEVARKLGLVGSRCCKRPEEERLSCAEDYLSLV 479
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE+VTKCCTESLVNRRPCFSAL  DETY PKEF   TFTFHADLCTL
Sbjct  480  LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYKPKEFVEGTFTFHADLCTL 539
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            PE EKQIKKQ+ALVELLKHKP ATEEQL+TV+G+F +FV KCCAA D EACFA EGPK+V
Sbjct  540  PEDEKQIKKQTALVELLKHKPHATEEQLRTVLGNFAAFVQKCCAAPDHEACFAVEGPKFV 599
Query  601  AAAQAALA 608
               +  LA
Sbjct  600  IEIRGILA 607

Sequence Alignment: 6. Allergen Name: Equ c 3 Sequence ID: CAA52194

 Score = 775.9 bits 3377,  Expect = 0
 Identities = 474/607 78%, Positives = 546/607 89%, Gaps = 1/607 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTF+SLL+LFSSAYSRGV RR+ H+SEIAHRFNDLGE+HF+GLVLVAFSQYLQQCPF
Sbjct  1    MKWVTFVSLLFLFSSAYSRGVLRRDTHKSEIAHRFNDLGEKHFKGLVLVAFSQYLQQCPF 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            EDHVKLVNEVTEFAK C AD+SA NC+KSLH L+GDKLCTVA+LR  YGE+ADCCEK+EP
Sbjct  61   EDHVKLVNEVTEFAKKCAADESAENCDKSLHTLFGDKLCTVATLRATYGELADCCEKQEP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            ERNECFL HKDD+P + +L  PE DA C AF+E+  +FLGKYLYE+ARRHPYFY PELL+
Sbjct  121  ERNECFLTHKDDHPNLPKL-KPEPDAQCAAFQEDPDKFLGKYLYEVARRHPYFYGPELLF 179
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            +AEEYK  FTECC A DK ACL PK+DAL+E++L SSAKERLKC+S+Q FGERA KAWSV
Sbjct  180  HAEEYKADFTECCPADDKLACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVKAWSV 239
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQKFPKA+FAE+SK+VTDL K+HKECCHGDLLECADDRADLAKYICE+QDSIS KLK
Sbjct  240  ARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDLLECADDRADLAKYICEHQDSISGKLK 299
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
             CC KP+L+KSHCI+EV+ D+LP+DLP LA DF EDKE+CK+Y++AKDVFLGTFLYEYSR
Sbjct  300  ACCDKPLLQKSHCIAEVKEDDLPSDLPALAADFAEDKEICKHYKDAKDVFLGTFLYEYSR 359
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHP+YSVSLLLR+AK YEATLEKCCA  DPPACY  VFD+F PLVEEP +LVK NC+LFE
Sbjct  360  RHPDYSVSLLLRIAKTYEATLEKCCAEADPPACYRTVFDQFTPLVEEPKSLVKKNCDLFE 419
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            ++GEY FQNAL+VRYTKK PQVSTPTLVE+ R+LGKVGS+CC  PE+ERL C+E++L++ 
Sbjct  420  EVGEYDFQNALIVRYTKKAPQVSTPTLVEIGRTLGKVGSRCCKLPESERLPCSENHLALA 479
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLCVLHEKTPVSE++TKCCT+SL  RRPCFSAL++DE YVPKEF AETFTFHAD+CTL
Sbjct  480  LNRLCVLHEKTPVSEKITKCCTDSLAERRPCFSALELDEGYVPKEFKAETFTFHADICTL 539
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            PE EKQIKKQSAL EL+KHKPKAT+EQLKTV+G+F +FV KCC  EDKEACFAEEGPKLV
Sbjct  540  PEDEKQIKKQSALAELVKHKPKATKEQLKTVLGNFSAFVAKCCGREDKEACFAEEGPKLV 599
Query  601  AAAQAALA 608
            A++Q ALA
Sbjct  600  ASSQLALA 607

Sequence Alignment: 7. Allergen Name: Cav p 4.0101 Sequence ID: Q6WDN9

 Score = 761.1 bits 3312,  Expect = 0
 Identities = 462/608 75%, Positives = 539/608 88%, Gaps = 0/608 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTRREAHQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPF 60
            MKWVTFISLL+LFSS YSRGV RREAH+SEIAHRFNDLGE HF+GLVL+ +SQ+LQ+ PF
Sbjct  1    MKWVTFISLLFLFSSVYSRGVFRREAHKSEIAHRFNDLGEGHFKGLVLITLSQHLQKSPF 60
Query  61   EDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEP 120
            E+HVKLVNEVT+FAK CVAD+SA NC K++  L+GDK+C + SLR+ YGE+ADCC K++P
Sbjct  61   EEHVKLVNEVTDFAKACVADESAQNCGKAIATLFGDKVCAIPSLRETYGELADCCAKEDP 120
Query  121  ERNECFLQHKDDNPGFGQLVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLY 180
            +R ECFLQHKDDNP +  +  PE +A+CTAF EN  RF+G YLYE++RRHPYFYAPELLY
Sbjct  121  DRVECFLQHKDDNPNLPPFERPEPEALCTAFKENNDRFIGHYLYEVSRRHPYFYAPELLY 180
Query  181  YAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFKAWSV 240
            YAE+YK  +TECCEAADKAACLTPK+DA++EK L SSA++RLKCASLQKFGERAFKAWSV
Sbjct  181  YAEKYKNALTECCEAADKAACLTPKLDAIKEKALVSSAQQRLKCASLQKFGERAFKAWSV 240
Query  241  ARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSISTKLK 300
            ARLSQKFPKAEFAEIS +VT L K+ KECCHGDLLECADDR +LAKY+CE+QDSIS+KLK
Sbjct  241  ARLSQKFPKAEFAEISTIVTSLTKVTKECCHGDLLECADDRQELAKYMCEHQDSISSKLK 300
Query  301  ECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLYEYSR 360
            ECC KP L+K+HCI E++RDELP +LP LAVDFVEDKEVCKN+ EAKDVFLGTFLYEYSR
Sbjct  301  ECCVKPTLQKAHCILEIQRDELPTELPDLAVDFVEDKEVCKNFAEAKDVFLGTFLYEYSR 360
Query  361  RHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNCELFE 420
            RHPEYS+ +LLR+AK YEA LEKCCA  DP ACYA VFDE++PL++EP  LV+ NCELF+
Sbjct  361  RHPEYSIGMLLRIAKGYEAKLEKCCAEADPHACYAKVFDELQPLIDEPKKLVQQNCELFD 420
Query  421  KLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDYLSVV 480
            KLGEYGFQNAL VRYT+K PQVSTPTLVE +R LG VG+KCC+ PE ERLSC E+YL+++
Sbjct  421  KLGEYGFQNALAVRYTQKAPQVSTPTLVEYARKLGSVGTKCCSLPETERLSCTENYLALI 480
Query  481  LNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHADLCTL 540
            LNRLC+LHEKTPVSERVTKCCTESLVNRRPCFSAL+VDETYVPK F A++FTFHAD+CTL
Sbjct  481  LNRLCILHEKTPVSERVTKCCTESLVNRRPCFSALHVDETYVPKPFHADSFTFHADICTL 540
Query  541  PEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEGPKLV 600
            PE EKQ+KKQ ALVEL+KHKPKA+EEQ+KTVMGDF +F+ KCC A++KEACF E+GPKLV
Sbjct  541  PEKEKQVKKQMALVELVKHKPKASEEQMKTVMGDFAAFLKKCCDADNKEACFTEDGPKLV 600
Query  601  AAAQAALA 608
            A  QA LA
Sbjct  601  AKCQATLA 608

Sequence Alignment: 8. Allergen Name: Gal d 5 Sequence ID: CAA43098

 Score = 492.8 bits 2135,  Expect = 3e-140
 Identities = 284/607 46%, Positives = 418/607 68%, Gaps = 4/607 0%
Query  1    MKWVTFISLLLLFSSAYSRGVTR--REA-HQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQ 57
            MKWVT+IS+++LFSSA SR + R  R+A H+SEIAHR+NDL EE F+ + ++ F+QYLQ+
Sbjct  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
Query  58   CPFEDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEK 117
            C +E   KLV +V ++A+ CVA++ A  C K L  ++ D++C V  LRD YG MADCC K
Sbjct  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
Query  118  KEPERNECFLQHKDDNPGFGQ-LVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAP 176
             +PERNECFL  K   P F Q    P +D +C  +++N   FLG ++Y +ARRHP++YAP
Sbjct  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
Query  177  ELLYYAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFK 236
             +L +A +++  +  CC+ +D  ACL  K   +REK    S K++  C  L++FG+R F+
Sbjct  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
Query  237  AWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSIS 296
            A  +  LSQK+PKA F+E+SK+V D   +HKECC GD++EC DD A +   +C  QD  S
Sbjct  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
Query  297  TKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLY 356
             K+K+CC KP++E+S+CI E E DE PADLP L   ++EDKEVCK+++   D F+  F+Y
Sbjct  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
Query  357  EYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNC 416
            EYSRRHPE+S+ L++R+AK YE+ LEKCC TD+P  CYA+  +++   ++E +++VKTNC
Sbjct  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
Query  417  ELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDY 476
            +L+   GE  F  ++L+RYTKK+PQV T  L+E  + +  +G+KCC   E  R++C+E Y
Sbjct  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
Query  477  LSVVLNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHAD 536
            LS+V++  C  +E TP+++ V++CC++   NRRPCF+A+ VD  YVP  F+ + F+F   
Sbjct  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
Query  537  LCTLPEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEG 596
            LC+ P  E+++ +   L+ L+K KP+ TEEQ+KT+   F + VDKCC   D   CF EEG
Sbjct  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
Query  597  PKLVAAAQAAL 607
              L+  ++A L
Sbjct  601  ANLIVQSRATL 611

Sequence Alignment: 9. Allergen Name: Can f 3 Sequence ID: AAB30434

 Score = 375.9 bits 1621,  Expect = 2e-105
 Identities = 234/263 88%, Positives = 252/263 95%, Gaps = 1/263 0%
Query  216  SSAKERLKCASLQKFGERAFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLL 275
            SSAKER+KCASLQKFG+RAFKAWSVARLSQ+FPKA+FAEISK+VTDL K+HKECCHGDLL
Sbjct  2    SSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLL 61
Query  276  ECADDRADLAKYICENQDSISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVE 335
            ECADDRADLAKY+CENQDSISTKLKECC KPVLEKS+C++EVERDELP DLP LA DFVE
Sbjct  62   ECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVE 121
Query  336  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYA 395
            DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPP CYA
Sbjct  122  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
Query  396  HVFDEFKPLVEEPHNLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLV-EVSRSL 454
             V+DEFKPLV+EP+NLVKTNCELFEKLGEYGFQNALLVRYTKK PQVSTPTLV EVSR L
Sbjct  182  KVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKL 241
Query  455  GKVGSKCCTHPEAERLSCAEDYLS 478
            GKVG+KCC  PE+ER+SCA+D+LS
Sbjct  242  GKVGTKCCKKPESERMSCADDFLS 265

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.