The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR
CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK
ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP
AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ
ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS
GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY
EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC
DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY
LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK
LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG
ANLIVQSRATLGIGA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA43098 Gal d 5 615 4209 965.6 0
P49822 Can f 3 608 2163 499.2 3.2e-142
P49064 Fel d 2 608 2135 492.8 2.7e-140
P02769 Bos d 6 607 2081 480.5 1.4e-136
CAA41735 Bos d 6 607 2079 480.1 1.9e-136
Q6WDN9 Cav p 4.0101 608 2067 477.3 1.2e-135
CAA52194 Equ c 3 607 2044 472.1 4.7e-134
P08835 Sus s 1.0101 607 2032 469.4 3.1e-133
AAB30434 Can f 3 265 1004 235.3 3.9e-63
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gal d 5 Sequence ID: CAA43098

 Score = 965.6 bits 4209,  Expect = 0
 Identities = 615/615 100%, Positives = 615/615 100%, Gaps = 0/615 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR
Sbjct  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK
Sbjct  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
            ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP
Sbjct  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
            AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ
Sbjct  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS
Sbjct  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
            GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY
Sbjct  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC
Sbjct  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY
Sbjct  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK
Sbjct  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG
Sbjct  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
Query  601  ANLIVQSRATLGIGA 615
            ANLIVQSRATLGIGA
Sbjct  601  ANLIVQSRATLGIGA 615

Sequence Alignment: 2. Allergen Name: Can f 3 Sequence ID: P49822

 Score = 499.2 bits 2163,  Expect = 3e-142
 Identities = 290/607 47%, Positives = 412/607 67%, Gaps = 4/607 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT+IS+ FLFSSA SR L R  R+A +KSEIAHRYNDL EE F+ + ++ F+QYLQ+
Sbjct  1    MKWVTFISLFFLFSSAYSRGLVR--REA-YKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQ 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            C +E   KL K+V ++A+ C A E    C K L ++  D++C V  LRD YG MADCC K
Sbjct  58   CPFEDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             +P+RNECFL+ K   P F  P   P  D +C  +QDN   FLG ++Y +ARRHP++YAP
Sbjct  118  QEPDRNECFLAHKDDNPGF-PPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAP 176
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L +A  ++  +  CC+ +D  ACL  K   +REK    S K+++ C  L++FGDR F+
Sbjct  177  ELLYYAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFK 236
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  +  LSQ++PKA F+E+SK V D   VHKECC GD++EC DD A +   +C  QD  S
Sbjct  237  AWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSIS 296
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
             K+K+CC+KP++E+SQC+ E E DE P DLPSL   ++EDKEVCK+++   D F+  F+Y
Sbjct  297  TKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLY 356
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHPE+S+ L++R+AK YE+ LEKCC TD+P  CYA   +++   + E Q++VKTNC
Sbjct  357  EYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNC 416
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            +L+   GE  F  ++L+RYTKK PQV T  L+E  +K+  +GTKCC+  E  RM+C++ +
Sbjct  417  ELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDF 476
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            LS+V++  C  +E TP+++ V++CCS+   NRRPCF+ + VD  YVP  FN + F+F   
Sbjct  477  LSVVLNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHAD 536
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            LC+ P  E++V +   L+ L+K KP+ T+EQ+KT+   F A V+KCC   +   CF EEG
Sbjct  537  LCTLPEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEG 596
Query  601  ANLIVQSRATL 611
              L+  ++A L
Sbjct  597  PKLVAAAQAAL 607

Sequence Alignment: 3. Allergen Name: Fel d 2 Sequence ID: P49064

 Score = 492.8 bits 2135,  Expect = 3e-140
 Identities = 284/607 46%, Positives = 418/607 68%, Gaps = 4/607 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT+IS+++LFSSA SR + R  R+A H+SEIAHR+NDL EE F+ + ++ F+QYLQ+
Sbjct  1    MKWVTFISLLLLFSSAYSRGVTR--REA-HQSEIAHRFNDLGEEHFRGLVLVAFSQYLQQ 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            C +E   KLV +V ++A+ CVA++ A  C K L  ++ D++C V  LRD YG MADCC K
Sbjct  58   CPFEDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDKLCTVASLRDKYGEMADCCEK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             +PERNECFL  K   P F Q    P +D +C  +++N   FLG ++Y +ARRHP++YAP
Sbjct  118  KEPERNECFLQHKDDNPGFGQ-LVTPEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAP 176
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L +A +++  +  CC+ +D  ACL  K   +REK    S K++  C  L++FG+R F+
Sbjct  177  ELLYYAEEYKGVFTECCEAADKAACLTPKVDALREKVLASSAKERLKCASLQKFGERAFK 236
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  +  LSQK+PKA F+E+SK+V D   +HKECC GD++EC DD A +   +C  QD  S
Sbjct  237  AWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLLECADDRADLAKYICENQDSIS 296
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
             K+K+CC KP++E+S+CI E E DE PADLP L   ++EDKEVCK+++   D F+  F+Y
Sbjct  297  TKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVEDKEVCKNYQEAKDVFLGTFLY 356
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHPE+S+ L++R+AK YE+ LEKCC TD+P  CYA+  +++   ++E +++VKTNC
Sbjct  357  EYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYAHVFDEFKPLVEEPHNLVKTNC 416
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            +L+   GE  F  ++L+RYTKK+PQV T  L+E  + +  +G+KCC   E  R++C+E Y
Sbjct  417  ELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVEVSRSLGKVGSKCCTHPEAERLSCAEDY 476
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            LS+V++  C  +E TP+++ V++CC++   NRRPCF+A+ VD  YVP  F+ + F+F   
Sbjct  477  LSVVLNRLCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFSAETFTFHAD 536
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            LC+ P  E+++ +   L+ L+K KP+ TEEQ+KT+   F + VDKCC   D   CF EEG
Sbjct  537  LCTLPEAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAEEG 596
Query  601  ANLIVQSRATL 611
              L+  ++A L
Sbjct  597  PKLVAAAQAAL 607

Sequence Alignment: 4. Allergen Name: Bos d 6 Sequence ID: P02769

 Score = 480.5 bits 2081,  Expect = 1e-136
 Identities = 273/606 45%, Positives = 409/606 67%, Gaps = 5/606 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT+IS+++LFSSA SR +  F RD  HKSEIAHR+ DL EE FK + +I F+QYLQ+
Sbjct  1    MKWVTFISLLLLFSSAYSRGV--FRRDT-HKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQ 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            C ++   KLV ++ ++A+ CVA+E    C K L ++  DE+C+V  LR++YG MADCC K
Sbjct  58   CPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             +PERNECFLS K   PD+  P  +P  + +C E++ +   F G ++Y +ARRHP++YAP
Sbjct  118  QEPERNECFLSHKDDSPDL--PKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAP 175
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L +A  +   +Q CC+  D GACL  K   MREK    S +Q+  C  +++FG+R ++
Sbjct  176  ELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALK 235
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  +  LSQK+PKA F EV+K+V D   VHKECC GD++EC DD A +   +C  QD  S
Sbjct  236  AWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTIS 295
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
             K+K+CC+KP++E+S+CI E E D  P +LP L   + EDK+VCK+++   DAF+  F+Y
Sbjct  296  SKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLY 355
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHPE+++ +++R+AK YE+ LE+CC  D+P  CY+   ++L + + E Q+++K NC
Sbjct  356  EYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNC 415
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            D +   GE  F  ++++RYT+K+PQV T  L+E  + +  +GT+CC   E  RM C+E Y
Sbjct  416  DQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDY 475
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            LS++++  C  +E TP+++ V++CC++   NRRPCF+A+  D  YVP  F+  +F+F   
Sbjct  476  LSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHAD 535
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            +C+ P  E+++ +   L+ L+K KP+ TEEQ+KT+ + F A VDKCC   D   CF  EG
Sbjct  536  ICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEG 595
Query  601  ANLIVQSRATL 611
              L+V ++  L
Sbjct  596  PKLVVSTQTAL 606

Sequence Alignment: 5. Allergen Name: Bos d 6 Sequence ID: CAA41735

 Score = 480.1 bits 2079,  Expect = 2e-136
 Identities = 273/606 45%, Positives = 409/606 67%, Gaps = 5/606 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT+IS+++LFSSA SR +  F RD  HKSEIAHR+ DL EE FK + +I F+QYLQ+
Sbjct  1    MKWVTFISLLLLFSSAYSRGV--FRRDT-HKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQ 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            C ++   KLV ++ ++A+ CVA+E    C K L ++  DE+C+V  LR++YG MADCC K
Sbjct  58   CPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             +PERNECFLS K   PD+  P  +P  + +C E++ +   F G ++Y +ARRHP++YAP
Sbjct  118  QEPERNECFLSHKDDSPDL--PKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAP 175
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L +A  +   +Q CC+  D GACL  K   MREK    S +Q+  C  +++FG+R ++
Sbjct  176  ELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALK 235
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  +  LSQK+PKA F EV+K+V D   VHKECC GD++EC DD A +   +C  QD  S
Sbjct  236  AWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTIS 295
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
             K+K+CC+KP++E+S+CI E E D  P +LP L   + EDK+VCK+++   DAF+  F+Y
Sbjct  296  SKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLY 355
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHPE+++ +++R+AK YE+ LE+CC  D+P  CY+   ++L + + E Q+++K NC
Sbjct  356  EYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNC 415
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            D +   GE  F  ++++RYT+K+PQV T  L+E  + +  +GT+CC   E  RM C+E Y
Sbjct  416  DQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDY 475
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            LS++++  C  +E TP+++ V++CC++   NRRPCF+A+  D  YVP  F+  +F+F   
Sbjct  476  LSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHAD 535
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            +C+ P  E+++ +   L+ L+K KP+ TEEQ+KT+ + F A VDKCC   D   CF  EG
Sbjct  536  ICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEG 595
Query  601  ANLIVQSRATL 611
              L+V ++  L
Sbjct  596  PKLVVSTQTAL 606

Sequence Alignment: 6. Allergen Name: Cav p 4.0101 Sequence ID: Q6WDN9

 Score = 477.3 bits 2067,  Expect = 1e-135
 Identities = 273/607 44%, Positives = 415/607 68%, Gaps = 4/607 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT+IS++FLFSS  SR +  F R+A HKSEIAHR+NDL E  FK + +IT++Q+LQ+
Sbjct  1    MKWVTFISLLFLFSSVYSRGV--FRREA-HKSEIAHRFNDLGEGHFKGLVLITLSQHLQK 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
              +E   KLV +V D+A+ CVA+E A  C K + ++  D++C +  LR++YG +ADCC+K
Sbjct  58   SPFEEHVKLVNEVTDFAKACVADESAQNCGKAIATLFGDKVCAIPSLRETYGELADCCAK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             DP+R ECFL  K   P++  P++RP  + +C  +++N   F+GH++Y V+RRHP++YAP
Sbjct  118  EDPDRVECFLQHKDDNPNL-PPFERPEPEALCTAFKENNDRFIGHYLYEVSRRHPYFYAP 176
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L +A  +++AL  CC+ +D  ACL  K   ++EKA   S +Q+  C  L++FG+R F+
Sbjct  177  ELLYYAEKYKNALTECCEAADKAACLTPKLDAIKEKALVSSAQQRLKCASLQKFGERAFK 236
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  +  LSQK+PKA F+E+S  V     V KECC GD++EC DD   +   +C +QD  S
Sbjct  237  AWSVARLSQKFPKAEFAEISTIVTSLTKVTKECCHGDLLECADDRQELAKYMCEHQDSIS 296
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
             K+K+CC KP +++++CI+E + DE P +LP L   ++EDKEVCK+F    D F+  F+Y
Sbjct  297  SKLKECCVKPTLQKAHCILEIQRDELPTELPDLAVDFVEDKEVCKNFAEAKDVFLGTFLY 356
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHPE+SI +++RIAKGYE+ LEKCC   +P  CYA   ++L   I E + +V+ NC
Sbjct  357  EYSRRHPEYSIGMLLRIAKGYEAKLEKCCAEADPHACYAKVFDELQPLIDEPKKLVQQNC 416
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            +L+   GE  F  ++ +RYT+K PQV T  L+E  +K+ ++GTKCC L E  R++C+E Y
Sbjct  417  ELFDKLGEYGFQNALAVRYTQKAPQVSTPTLVEYARKLGSVGTKCCSLPETERLSCTENY 476
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            L+++++  C  +E TP+++ V++CC++   NRRPCF+A+ VD  YVP PF+ D F+F   
Sbjct  477  LALILNRLCILHEKTPVSERVTKCCTESLVNRRPCFSALHVDETYVPKPFHADSFTFHAD 536
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            +C+ P +E++V +   L+ L+K KP+ +EEQ+KT+   F A + KCC   +   CF E+G
Sbjct  537  ICTLPEKEKQVKKQMALVELVKHKPKASEEQMKTVMGDFAAFLKKCCDADNKEACFTEDG 596
Query  601  ANLIVQSRATL 611
              L+ + +ATL
Sbjct  597  PKLVAKCQATL 607

Sequence Alignment: 7. Allergen Name: Equ c 3 Sequence ID: CAA52194

 Score = 472.1 bits 2044,  Expect = 5e-134
 Identities = 270/606 44%, Positives = 407/606 67%, Gaps = 5/606 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT++S++FLFSSA SR + R  RD  HKSEIAHR+NDL E+ FK + ++ F+QYLQ+
Sbjct  1    MKWVTFVSLLFLFSSAYSRGVLR--RDT-HKSEIAHRFNDLGEKHFKGLVLVAFSQYLQQ 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            C +E   KLV +V ++A+KC A+E A  C K L ++  D++C V  LR +YG +ADCC K
Sbjct  58   CPFEDHVKLVNEVTEFAKKCAADESAENCDKSLHTLFGDKLCTVATLRATYGELADCCEK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             +PERNECFL+ K  +P++  P  +P  D  C  +Q++   FLG ++Y VARRHP++Y P
Sbjct  118  QEPERNECFLTHKDDHPNL--PKLKPEPDAQCAAFQEDPDKFLGKYLYEVARRHPYFYGP 175
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L  A +++  +  CC   D  ACL  K   ++E+    S K++  C  ++ FG+R  +
Sbjct  176  ELLFHAEEYKADFTECCPADDKLACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVK 235
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  +  LSQK+PKA F+EVSK V D   VHKECC GD++EC DD A +   +C +QD  S
Sbjct  236  AWSVARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDLLECADDRADLAKYICEHQDSIS 295
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
            GK+K CC+KP++++S+CI E + D+ P+DLP+L   + EDKE+CK ++   D F+  F+Y
Sbjct  296  GKLKACCDKPLLQKSHCIAEVKEDDLPSDLPALAADFAEDKEICKHYKDAKDVFLGTFLY 355
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHP++S+ L++RIAK YE+ LEKCC   +P  CY    +Q+   ++E + +VK NC
Sbjct  356  EYSRRHPDYSVSLLLRIAKTYEATLEKCCAEADPPACYRTVFDQFTPLVEEPKSLVKKNC 415
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            DL+ + GE DF  ++++RYTKK PQV T  L+E G+ +  +G++CC+L E  R+ CSE +
Sbjct  416  DLFEEVGEYDFQNALIVRYTKKAPQVSTPTLVEIGRTLGKVGSRCCKLPESERLPCSENH 475
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            L++ ++  C  +E TP+++ +++CC+   A RRPCF+A+ +D  YVP  F  + F+F   
Sbjct  476  LALALNRLCVLHEKTPVSEKITKCCTDSLAERRPCFSALELDEGYVPKEFKAETFTFHAD 535
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            +C+ P +E+++ +   L  L+K KP+ T+EQ+KT+   F+A V KCC + D   CF EEG
Sbjct  536  ICTLPEDEKQIKKQSALAELVKHKPKATKEQLKTVLGNFSAFVAKCCGREDKEACFAEEG 595
Query  601  ANLIVQSRATL 611
              L+  S+  L
Sbjct  596  PKLVASSQLAL 606

Sequence Alignment: 8. Allergen Name: Sus s 1.0101 Sequence ID: P08835

 Score = 469.4 bits 2032,  Expect = 3e-133
 Identities = 267/606 44%, Positives = 408/606 67%, Gaps = 5/606 0%
Query  1    MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQR 60
            MKWVT+IS++FLFSSA SR +  F RD  +KSEIAHR+ DL E+ FK + +I F+Q+LQ+
Sbjct  1    MKWVTFISLLFLFSSAYSRGV--FRRDT-YKSEIAHRFKDLGEQYFKGLVLIAFSQHLQQ 57
Query  61   CSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSK 120
            C YE   KLV++V ++A+ CVA+E A  C K + ++  D++C +  LR+ YG +ADCC K
Sbjct  58   CPYEEHVKLVREVTEFAKTCVADESAENCDKSIHTLFGDKLCAIPSLREHYGDLADCCEK 117
Query  121  ADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAP 180
             +PERNECFL  K   PD   P  +P    +C ++Q++   F G ++Y +ARRHP++YAP
Sbjct  118  EEPERNECFLQHKNDNPDI--PKLKPDPVALCADFQEDEQKFWGKYLYEIARRHPYFYAP 175
Query  181  AILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQ 240
             +L +A+ ++  +  CC+ +D  ACL  K   +REK    + KQ+  C  +++FG+R F+
Sbjct  176  ELLYYAIIYKDVFSECCQAADKAACLLPKIEHLREKVLTSAAKQRLKCASIQKFGERAFK 235
Query  241  ARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFS 300
            A  L  LSQ++PKA F+E+SK V D   VHKECC GD++EC DD A +   +C  QD  S
Sbjct  236  AWSLARLSQRFPKADFTEISKIVTDLAKVHKECCHGDLLECADDRADLAKYICENQDTIS 295
Query  301  GKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIEDKEVCKSFEAGHDAFMAEFVY 360
             K+K+CC+KP++E+S+CI EA+ DE PADL  L   ++EDKEVCK+++     F+  F+Y
Sbjct  296  TKLKECCDKPLLEKSHCIAEAKRDELPADLNPLEHDFVEDKEVCKNYKEAKHVFLGTFLY 355
Query  361  EYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYANAQEQLNQHIKETQDVVKTNC 420
            EYSRRHP++S+ L++RIAK YE+ LE CC  ++P  CYA   +++   + E ++++K NC
Sbjct  356  EYSRRHPDYSVSLLLRIAKIYEATLEDCCAKEDPPACYATVFDKFQPLVDEPKNLIKQNC 415
Query  421  DLLHDHGEADFLKSILIRYTKKMPQVPTDLLLETGKKMTTIGTKCCQLGEDRRMACSEGY 480
            +L+   GE  F  ++++RYTKK+PQV T  L+E  +K+  +G++CC+  E+ R++C+E Y
Sbjct  416  ELFEKLGEYGFQNALIVRYTKKVPQVSTPTLVEVARKLGLVGSRCCKRPEEERLSCAEDY 475
Query  481  LSIVIHDTCRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVPPPFNPDMFSFDEK 540
            LS+V++  C  +E TP+++ V++CC++   NRRPCF+A+  D  Y P  F    F+F   
Sbjct  476  LSLVLNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYKPKEFVEGTFTFHAD 535
Query  541  LCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEG 600
            LC+ P +E+++ +   L+ L+K KP+ TEEQ++T+   F A V KCC   D   CF  EG
Sbjct  536  LCTLPEDEKQIKKQTALVELLKHKPHATEEQLRTVLGNFAAFVQKCCAAPDHEACFAVEG 595
Query  601  ANLIVQSRATL 611
              ++++ R  L
Sbjct  596  PKFVIEIRGIL 606

Sequence Alignment: 9. Allergen Name: Can f 3 Sequence ID: AAB30434

 Score = 235.3 bits 1004,  Expect = 4e-63
 Identities = 131/262 50%, Positives = 188/262 71%, Gaps = 1/262 0%
Query  221  SVKQQYFCGILKQFGDRVFQARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVE 280
            S K+++ C  L++FGDR F+A  +  LSQ++PKA F+E+SK V D   VHKECC GD++E
Sbjct  3    SAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLE 62
Query  281  CMDDMARMMSNLCSQQDVFSGKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIED 340
            C DD A +   +C  QD  S K+K+CC+KP++E+SQC+ E E DE P DLPSL   ++ED
Sbjct  63   CADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVED 122
Query  341  KEVCKSFEAGHDAFMAEFVYEYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYAN 400
            KEVCK+++   D F+  F+YEYSRRHPE+S+ L++R+AK YE+ LEKCC TD+P  CYA 
Sbjct  123  KEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
Query  401  AQEQLNQHIKETQDVVKTNCDLLHDHGEADFLKSILIRYTKKMPQVPTD-LLLETGKKMT 459
              +++   + E Q++VKTNC+L+   GE  F  ++L+RYTKK PQV T  L++E  +K+ 
Sbjct  183  VLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKLG 242
Query  460  TIGTKCCQLGEDRRMACSEGYLS 482
             +GTKCC+  E  RM+C++ +LS
Sbjct  243  KVGTKCCKKPESERMSCADDFLS 265

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.