The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKYSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDASKHHD
WVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNH
PDVDYIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVY
VIDTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVK
VLRSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAV
NAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPG
LNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLI
AIGTVGALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPS
LSELEDDFEKAKESAGRKAHHVGGKL
Sequence Info Allergen Name Length Opt Bits Score E Value
ACF19589 Cur l 4.0101 506 3292 756.6 7e-220
A0A0F6N3V8 Alt a 15.0101 507 2854 656.8 8e-190
AAX14379 Cla h 9.0101 518 2337 539.0 2.5e-154
AAG44478 Pen o 18 503 2250 519.1 2.2e-148
Y13338 Asp f 18.0101 495 2188 505.0 3.9e-144
AAF71379 Pen ch 18 494 2160 498.6 3.2e-142
ABQ59329 Cla c 9.0101 388 1921 444.2 6.1e-126
A0A0U1Y1N5 Fus p 9.0101 386 1739 402.7 1.9e-113
Q32ZM1 Rho m 2.0101 342 1424 331.0 6.6e-92
AAD52013 Tri r 2.0101 412 810 190.9 1.1e-49
AAF23726 Pen ch 13 397 527 126.4 2.8e-30
ADE74975 Asp v 13.0101 403 466 112.5 4.4e-26
P28296 Asp f 13 403 444 107.5 1.4e-24
AAD47202 Asp fl protease 403 419 101.8 7.4e-23
CAA35594 Asp o 13 403 419 101.8 7.4e-23
AAD25926 Pen c 13.0101 397 340 83.8 1.9e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cur l 4.0101 Sequence ID: ACF19589

 Score = 756.6 bits 3292,  Expect = 7e-220
 Identities = 506/506 100%, Positives = 506/506 100%, Gaps = 0/506 0%
Query  1    MKYSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDASKHHD 60
            MKYSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDASKHHD
Sbjct  1    MKYSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDASKHHD 60
Query  61   WVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNH 120
            WVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNH
Sbjct  61   WVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNH 120
Query  121  PDVDYIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVY 180
            PDVDYIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVY
Sbjct  121  PDVDYIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVY 180
Query  181  VIDTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVK 240
            VIDTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVK
Sbjct  181  VIDTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVK 240
Query  241  VLRSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAV 300
            VLRSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAV
Sbjct  241  VLRSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAV 300
Query  301  NAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPG 360
            NAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPG
Sbjct  301  NAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPG 360
Query  361  LNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLI 420
            LNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLI
Sbjct  361  LNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLI 420
Query  421  AIGTVGALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPS 480
            AIGTVGALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPS
Sbjct  421  AIGTVGALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPS 480
Query  481  LSELEDDFEKAKESAGRKAHHVGGKL 506
            LSELEDDFEKAKESAGRKAHHVGGKL
Sbjct  481  LSELEDDFEKAKESAGRKAHHVGGKL 506

Sequence Alignment: 2. Allergen Name: Alt a 15.0101 Sequence ID: A0A0F6N3V8

 Score = 656.8 bits 2854,  Expect = 8e-190
 Identities = 429/476 90%, Positives = 449/476 94%, Gaps = 1/476 0%
Query  30   PVLSSTSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNTQERMELRKRSSDLPVSNEV 89
            P     SAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKN +ERMELRKRSS +PV+ EV
Sbjct  1    PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEV 60
Query  90   FAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENNSPWG 149
            F GLKH YE++G+KGYSGHFDDET+EAIRNHPDVDYIERDSEV  LG DEPE E NSPWG
Sbjct  61   FDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWG 120
Query  150  LARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPNGDAD 209
            LARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTN  HVDFEGRAKWGKTIPNGDAD
Sbjct  121  LARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPNGDAD 180
Query  210  EDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHSEAVS 269
            EDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVE+AAK+HS+ V 
Sbjct  181  EDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQ 240
Query  270  AAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYSPAAA 329
            AAK+GKKKGFKGS ANMSLGGGKSTTLD+AVNAAVDAG+HFAVAAGNDNADSCNYSPAAA
Sbjct  241  AAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA 300
Query  330  ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASPHIAG 389
            ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGS+HATNTISGTSMASPHIAG
Sbjct  301  ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAG 360
Query  390  LLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNGGGSSNY 449
            LLAYMLSLQPAKDSAYAVADITPKKLKANLI++ TVGALSDVP NT N+LAWNGGGSSNY
Sbjct  361  LLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNY 420
Query  450  TDIIEKGGYTVKKAASKEEEKESEFRITIPSLSELEDDFEKAKESAGRKAHHVGGKL 506
            T+I+EKGGYTVKKAA K EE ESEFRITIPSLSE+EDDFEKAKESAGR AH VGGKL
Sbjct  421  TEIVEKGGYTVKKAAEKNEE-ESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGKL 476

Sequence Alignment: 3. Allergen Name: Cla h 9.0101 Sequence ID: AAX14379

 Score = 539.0 bits 2337,  Expect = 2e-154
 Identities = 355/496 71%, Positives = 412/496 83%, Gaps = 7/496 1%
Query  8    ALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKD--ASKHHDWVQSV 65
            +L  LA ASP +   +IH  +AP++S+++AKE+ ++YM+ FK HV    A++HH WVQ +
Sbjct  9    SLATLATASPVL-VNSIHNDAAPIISASNAKEIADNYMIKFKDHVTQNLAAEHHGWVQDL 67
Query  66   HSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSG-LKGYSGHFDDETLEAIRNHPDVD 124
            H K    + ELRKRS   P+ +++F GLKHTY ++G L GY+GHFD++ +E IR HPDV+
Sbjct  68   HEKTQVAKTELRKRSQS-PMVDDIFNGLKHTYNIAGGLMGYAGHFDEDVIEQIRRHPDVE 126
Query  125  YIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDT 184
             +ERD EV +LG  E E E N+PWGLARISHRDSLSFGT+NKYLY  DGGEGVDVYV+DT
Sbjct  127  LVERDQEVHVLGS-ESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDT 185
Query  185  GTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRS 244
            GTNVDHVDFEGRA WGKTIP GDADEDGNGHGTHCSGTVAGKKYGVAKKAHV AVKVLRS
Sbjct  186  GTNVDHVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRS 245
Query  245  NGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAV 304
            NGSG+MSDVVKGVE+AA+SH E VS  K GK+KGFKGSTANMSLGGGKS  LD AVNAAV
Sbjct  246  NGSGSMSDVVKGVEYAAESHLEQVSITKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAV 305
Query  305  DAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNIL 364
            DAG+HFAVAAGNDNADSCNYSPAAAENAVTVGASTL DERAYFSNYGKCNDIFAPGLNI 
Sbjct  306  DAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLADERAYFSNYGKCNDIFAPGLNIQ 365
Query  365  STWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGT 424
            STWIGSK+A NTISGTSMASPH+AGLLAY+LSLQPAKDSA+AVADI+PKKLKANLI+I T
Sbjct  366  STWIGSKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIAT 425
Query  425  VGALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPSL-SE 483
            VGAL+DVPSNTAN+LAWNGGG SNY+ I+EKGGY      +  EE ESE ++    + SE
Sbjct  426  VGALTDVPSNTANILAWNGGGESNYSAIVEKGGYKATHRPTMLEEIESEAKVASKKVYSE 485
Query  484  LEDDFEKAKESAGRKAHHVGGKL 506
             ++   K  E   +    + G+L
Sbjct  486  GDELAHKVAELTEKVEDLIAGEL 508

Sequence Alignment: 4. Allergen Name: Pen o 18 Sequence ID: AAG44478

 Score = 519.1 bits 2250,  Expect = 2e-148
 Identities = 346/454 76%, Positives = 395/454 87%, Gaps = 11/454 2%
Query  9    LPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHV--KDASKHHDWVQSVH 66
            LP LAAASPT+S ETIH  +AP++SSTSAKE+P+SY+VVFKKHV    AS HH WVQ +H
Sbjct  10   LPLLAAASPTWS-ETIHNGAAPLISSTSAKEIPDSYIVVFKKHVGASAASAHHSWVQDIH 68
Query  67   SKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSG-LKGYSGHFDDETLEAIRNHPDVDY 125
            S N   RMEL+KRS  +   +E + G+KHT+ ++G L GY+GHF ++ +E +R HPDV+Y
Sbjct  69   SDNV--RMELKKRSL-FGFESEPYLGVKHTFHVAGSLMGYAGHFHEDVIEQVRRHPDVEY 125
Query  126  IERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTG 185
            IE+DSEV  +  ++P  E N+PWGLARISHRDSLSFG++NKYLYA DGGEGVD YVIDTG
Sbjct  126  IEKDSEVHHF--EDPAIEKNAPWGLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTG 183
Query  186  TNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSN 245
            TNVDHVDFEGRA WGKTIP GD D DGNGHGTHCSGT+AGKKYGVAKKA+VYAVKVLRSN
Sbjct  184  TNVDHVDFEGRASWGKTIPQGDQDVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSN 243
Query  246  GSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVD 305
            GSGTMSDVVKGVE+AA++H +   AAK+GK KGFKGS ANMSLGGG S TLD+AVNAAVD
Sbjct  244  GSGTMSDVVKGVEWAAEAHIKKSKAAKDGKAKGFKGSVANMSLGGGSSRTLDLAVNAAVD 303
Query  306  AGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILS 365
            AG+HFAVAAGNDNAD+CNYSPAAAE AVTVGASTL DERAYFSNYGKC DIFAPGLNILS
Sbjct  304  AGMHFAVAAGNDNADACNYSPAAAEKAVTVGASTLADERAYFSNYGKCTDIFAPGLNILS 363
Query  366  TWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTV 425
            TWIGSK+A NTISGTSMASPHIAGLLAY +SLQPA DSAYAV +ITPKKLK  LI I T 
Sbjct  364  TWIGSKYAVNTISGTSMASPHIAGLLAYYVSLQPASDSAYAVEEITPKKLKDALITIATS 423
Query  426  GALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEK 470
            GALSD+PS+T N+LAWNGGGSSNYT+I+ KGGY  K  AS+  +K
Sbjct  424  GALSDIPSDTPNLLAWNGGGSSNYTEIVSKGGY--KAGASESMKK 466

Sequence Alignment: 5. Allergen Name: Asp f 18.0101 Sequence ID: Y13338

 Score = 505.0 bits 2188,  Expect = 4e-144
 Identities = 332/464 71%, Positives = 391/464 84%, Gaps = 9/464 1%
Query  1    MK-YSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHV--KDASK 57
            MK Y  ++ LP L AASP    ++IH  +AP+LSS +AKEVP+SY+VVFKKHV  + A+ 
Sbjct  1    MKGYLSLSILPLLVAASPVV-VDSIHNGAAPILSSMNAKEVPDSYIVVFKKHVNAESAAA 59
Query  58   HHDWVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSG-LKGYSGHFDDETLEA 116
            HH WVQ +HS    ER+ELRKRS  +    E + GLK+T++++G L GYSGHF ++ +E 
Sbjct  60   HHSWVQDIHSAQN-ERVELRKRSL-FGFGEEAYLGLKNTFDIAGSLVGYSGHFHEDVIEQ 117
Query  117  IRNHPDVDYIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEG 176
            +R HPDV+YIE+DSEV  +  ++P  E ++PWGLARISHRDSLSFGT+NKYLYA++GGEG
Sbjct  118  VRKHPDVEYIEKDSEVHTM--EDPTVEKSAPWGLARISHRDSLSFGTFNKYLYASEGGEG 175
Query  177  VDVYVIDTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHV 236
            VD Y IDTG NVDHVDFEGRA+WGKTIP  D D DGNGHGTHCSGT+AG+KYGVAKKA++
Sbjct  176  VDAYTIDTGINVDHVDFEGRAQWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANL 235
Query  237  YAVKVLRSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTL 296
            YAVKVLRS+GSGTMSDVV GVE+A KSH + V  AK+GK KGFKGS ANMSLGGGKS TL
Sbjct  236  YAVKVLRSSGSGTMSDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTL 295
Query  297  DMAVNAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDI 356
            + AVNA V+AGLHFAVAAGNDNAD+CNYSPAAAEN +TVGASTL DERAYFSNYGKC DI
Sbjct  296  EAAVNAGVEAGLHFAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNYGKCTDI 355
Query  357  FAPGLNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLK 416
            FAPGLNILSTWIGSKHA NTISGTSMASPHIAGLLAY +SLQP+KDSA+AV ++TPKKLK
Sbjct  356  FAPGLNILSTWIGSKHAVNTISGTSMASPHIAGLLAYFVSLQPSKDSAFAVDELTPKKLK 415
Query  417  ANLIAIGTVGALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEE 469
             ++IAI T GAL+D+PS+T N+LAWNGGGSSNYTDII  GGY V  +     E
Sbjct  416  KDIIAIATQGALTDIPSDTPNLLAWNGGGSSNYTDIIASGGYKVNASVKDRFE 468

Sequence Alignment: 6. Allergen Name: Pen ch 18 Sequence ID: AAF71379

 Score = 498.6 bits 2160,  Expect = 3e-142
 Identities = 328/453 72%, Positives = 384/453 84%, Gaps = 12/453 2%
Query  9    LPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHV--KDASKHHDWVQSVH 66
            LP L AASP  +  +IH  +AP+LSS ++K++P+SY+VVFKKHV    AS H+ W+Q VH
Sbjct  10   LPLLVAASPV-AVNSIHNDAAPILSSMTSKDIPDSYIVVFKKHVDPSSASAHQSWLQEVH 68
Query  67   SKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSG-LKGYSGHFDDETLEAIRNHPDVDY 125
            + +T  RMEL+KRS  +    E F GLKHT+ ++G L GY+GHF ++ +E IR HPDVDY
Sbjct  69   TAHTG-RMELKKRSL-FGFDFEAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDY 126
Query  126  IERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTG 185
            IE+DSEVR +   E   E N+PWGLARISHR+SLSFG +NKYLYA +GGEGVD YVIDTG
Sbjct  127  IEKDSEVRTM--SEGSVEKNAPWGLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTG 184
Query  186  TNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSN 245
             NV HVDFEGRA WGKTIP GDADEDGNGHGTHCSGT+AGKK+GVAKKA+VYAVKVLRSN
Sbjct  185  ANVKHVDFEGRANWGKTIPQGDADEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSN 244
Query  246  GSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVD 305
            GSGTMSDVVKGVE+AA++H   +  +K G KK FKGS ANMSLGGG S TLD+AVNAAVD
Sbjct  245  GSGTMSDVVKGVEWAAEAH---IKKSKKGDKK-FKGSVANMSLGGGSSRTLDLAVNAAVD 300
Query  306  AGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILS 365
            AG+HFAVAAGNDNAD+CNYSPAAAE A+TVGASTL DERAYFSNYGKC DIFAPGLNILS
Sbjct  301  AGIHFAVAAGNDNADACNYSPAAAEKAITVGASTLADERAYFSNYGKCTDIFAPGLNILS 360
Query  366  TWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTV 425
            TW+GS HATNTISGTSMASPHIAGLLAY +SL PAKDSAYAVAD+TPK+LKA LI++ T 
Sbjct  361  TWVGSDHATNTISGTSMASPHIAGLLAYYVSLAPAKDSAYAVADVTPKQLKAALISVATE 420
Query  426  GALSDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEK 470
            G L+D+PS+T N+LAWNGGGS+NYT I+  GGY    A +  E++
Sbjct  421  GTLTDIPSDTPNLLAWNGGGSANYTKILADGGYKAHNAETTVEDR 465

Sequence Alignment: 7. Allergen Name: Cla c 9.0101 Sequence ID: ABQ59329

 Score = 444.2 bits 1921,  Expect = 6e-126
 Identities = 296/377 78%, Positives = 324/377 85%, Gaps = 2/377 0%
Query  129  DSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNV 188
            D EV +L   E E E N+PWGLARISHRDSLSFGT+NKYLY  DGGEGVDVYV+DTGTNV
Sbjct  1    DQEVHVLKS-ESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNV 59
Query  189  DHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSG 248
            DHVDFEGRA WGKTIP GDADEDGNGHGTHCSGTVAGKKYGVAKKAHV AVKVLRSNGSG
Sbjct  60   DHVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSG 119
Query  249  TMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGL 308
            +MSDVVKGVE+AA+SH E VS AK GK+KGFKGSTANMSLGGGKS  LD AVNAAVDAG+
Sbjct  120  SMSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGI 179
Query  309  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWI 368
            HFAVAAGNDNADSCNYSPAAAENAVTVGASTL DERAYFSNYGKCNDIFAPGLNI STWI
Sbjct  180  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWI 239
Query  369  GSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGAL 428
            GSK+A NTISGTSMASPH+AGLLAY+LSLQPAKDSA+AVADI+PKKLKANLI+I TVGAL
Sbjct  240  GSKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGAL 299
Query  429  SDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPSL-SELEDD 487
            +DVPSNTAN+LAWNGGG SNY+ I+EKGGY      +  EE ESE ++    + SE ++ 
Sbjct  300  TDVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDEL 359
Query  488  FEKAKESAGRKAHHVGGKL 506
             +K  E   +    + G L
Sbjct  360  AKKVAELTEKIEDLISGDL 378

Sequence Alignment: 8. Allergen Name: Fus p 9.0101 Sequence ID: A0A0U1Y1N5

 Score = 402.7 bits 1739,  Expect = 2e-113
 Identities = 264/362 72%, Positives = 298/362 82%, Gaps = 5/362 1%
Query  141  ETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWG 200
            ETE  +PWGLARISHR++L+FGT+NKYLY++DGGEGVD Y++DTGTNVDHVDFEGRA WG
Sbjct  6    ETERQAPWGLARISHRNTLNFGTFNKYLYSSDGGEGVDAYIVDTGTNVDHVDFEGRAHWG 65
Query  201  KTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFA 260
            KTIP+GDADEDGNGHGTHCSGTVAGKKYGVAKKA+VYAVKVLRSNGSG+MSDVVKGVEFA
Sbjct  66   KTIPSGDADEDGNGHGTHCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKGVEFA 125
Query  261  AKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNAD 320
            A SH E    AK+GK+KGFKGS ANMSLGGGK+  LD AVNAAV  G+HFAVAAGNDNAD
Sbjct  126  ATSHLEQKKKAKDGKRKGFKGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGNDNAD 185
Query  321  SCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGT 380
            +CNYSPAAA   VTVGAS L D RAYFSNYGKC DIFAPGLNI STWIGSK+A NTISGT
Sbjct  186  ACNYSPAAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNTISGT 245
Query  381  SMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLA 440
            SMASPHIAGLLAY LSLQPA+DS YA+A ITPKKLK NLI++ T  ALSD+PS+T N+LA
Sbjct  246  SMASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALSDIPSDTPNLLA 305
Query  441  WNGGGSSNYTDIIEKGGYTVKKAASKEEEK-----ESEFRITIPSLSELEDDFEKAKESA 495
            WNGGG S+Y  I+E G Y VK A S   E+     E E  +    L+    ++    E  
Sbjct  306  WNGGGCSDYKKIVEAGSYKVKAAPSSRVEEIKHAVEQEVNLVSGKLTTGAKELGSKAEKF 365
Query  496  GRKAHHV 502
             +K H +
Sbjct  366  SKKIHEL 372

Sequence Alignment: 9. Allergen Name: Rho m 2.0101 Sequence ID: Q32ZM1

 Score = 331.0 bits 1424,  Expect = 7e-92
 Identities = 219/328 66%, Positives = 262/328 79%, Gaps = 11/328 3%
Query  111  DETLEAIRNHPDVDYIERDSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYA 170
            ++ +E +R  P V++IE++S V     +E      +PWGLARISHRD LS+G++++YLY 
Sbjct  6    EDLIEQVRQLPMVNFIEKNSLVH---ANEFTVAKGAPWGLARISHRDPLSLGSFDQYLYD 62
Query  171  ADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGV 230
            ++GG GV  YVIDTG NV H  FEGRAKWGKTIP GD DEDGNGHGTHC+GT+    YGV
Sbjct  63   SNGGTGVTSYVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYGV 122
Query  231  AKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGG 290
            AK A + AVKVLRSNGSG+MSDV+KGVEFA KSH ++V   KN     F  STANMSLGG
Sbjct  123  AKNAEIVAVKVLRSNGSGSMSDVIKGVEFAVKSHQDSVKKGKNS----F--STANMSLGG 176
Query  291  GKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNY 350
            GKS  LD+AVNAAV AGLHFAVAAGN+N D+CN SPA+AENA+TVGAST+ D RAYFSNY
Sbjct  177  GKSPALDLAVNAAVKAGLHFAVAAGNENQDACNTSPASAENAITVGASTISDARAYFSNY 236
Query  351  GKCNDIFAPGLNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVA-- 408
            GKC DIFAPGLNILST+IGS  AT  +SGTSMASPHIAGLL Y LSLQP+ DS + +   
Sbjct  237  GKCVDIFAPGLNILSTYIGSDAATAYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAE 296
Query  409  DITPKKLKANLIAIGTVGALSDVPSNTANVLAWNGGGSS 447
             ITP +LK NLIA GT   L+D+P++T N+LA+NG G +
Sbjct  297  GITPAQLKKNLIAFGTPDVLADIPADTPNILAFNGAGQN 335

Sequence Alignment: 10. Allergen Name: Tri r 2.0101 Sequence ID: AAD52013

 Score = 190.9 bits 810,  Expect = 1e-49
 Identities = 177/391 45%, Positives = 245/391 62%, Gaps = 38/391 9%
Query  8    ALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDAS--KHHDWVQSV 65
            A+P + AA  T +   I  ++ P      A+ +PN Y+VV K+ V D +   H  W+   
Sbjct  7    AIPIVLAALSTVNGARIL-EAGP-----HAEAIPNKYIVVMKREVSDEAFNAHTTWL--- 57
Query  66   HSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELSGL-KGYSGHFDDETLEAIRNHPDVD 124
             S++   R+ +R+  S  P+     AG++  Y L G+ + YSG FDD  ++ I +H DVD
Sbjct  58   -SQSLNSRI-MRRAGSSKPM-----AGMQDKYSLGGIFRAYSGEFDDAMIKDISSHDDVD 110
Query  125  YIERDSEVRIL-GGDEPETENNSP-WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVI 182
            +IE D  VR    G     ++N P WGLAR+  +     GT   Y Y    G+GV  Y+I
Sbjct  111  FIEPDFVVRTTTNGTNLTHQDNVPSWGLARVGSKKPG--GT--TYYYDPSAGKGVTAYII 166
Query  183  DTGTNVDHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVL 242
            DTG ++DH DF+GRAKWG+   +   + D NGHGTH +GTV G KYG+AK   + AVKVL
Sbjct  167  DTGIDIDHEDFQGRAKWGENFVD-QQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVL 225
Query  243  RSNGSGTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNA 302
              +GSG+ S V+KG+E+A +      S   NG  K    S  NMSLGG +S   + A  A
Sbjct  226  DCDGSGSNSGVIKGMEWAMRQ----ASGGGNGTAKAAGKSVMNMSLGGPRSEASNQAAKA 281
Query  303  AVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLN 362
              DAG+  AVAAGN+N D+ + SPA+  +  TV AST  D +A FSNYG   D++APG +
Sbjct  282  ISDAGIFMAVAAGNENMDAQHSSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKD 341
Query  363  ILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAI 422
            I S   G   +T+T+SGTSMASPH+ GL AY++ L   K     + D T KK+  ++I  
Sbjct  342  ITSLKPGG--STDTLSGTSMASPHVCGLGAYLIGL--GKQGGPGLCD-TIKKMANDVIQS 396
Query  423  ---GTVGAL 428
               GT G L
Sbjct  397  PGEGTTGKL 405

Sequence Alignment: 11. Allergen Name: Pen ch 13 Sequence ID: AAF23726

 Score = 126.4 bits 527,  Expect = 3e-30
 Identities = 167/388 43%, Positives = 245/388 63%, Gaps = 47/388 12%
Query  12   LAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDA--SKHHDWVQSVHSKN 69
            L   + +++T  +      + +S +   +P+SY+VV    V  A  S H +W  +VH+  
Sbjct  4    LKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVHA-- 61
Query  70   TQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERD 129
               R+  RK     P       G KH +E++GLKGY+  FD+ T + I N P V YIE D
Sbjct  62   ---RLSRRKNGETGP-------G-KH-FEINGLKGYTASFDENTAKDIANDPAVKYIEPD 109
Query  130  SEVRILGGDEPETENNSP-WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNV 188
                I+       ++N P WGLARIS + +   GT   Y Y +  GEGV  Y +DTG ++
Sbjct  110  ---MIVNATANVVQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDI 162
Query  189  DHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSG 248
             H DF GRAKWG  + + D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG
Sbjct  163  SHSDFGGRAKWGTNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSG 221
Query  249  TMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGL 308
            T S V+ G+++A K   +A S   NGK         N SLGG  S  ++ A    V +G+
Sbjct  222  TNSGVISGMDWAVK---DAKSRGANGK------YVMNTSLGGEFSKAVNDAAANVVKSGI 272
Query  309  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWI 368
             ++VAAGN+  ++ N SPA+A  A T+ AST  D  A F+N+G   D++APG +I + + 
Sbjct  273  FLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYP 332
Query  369  GSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGAL 428
            G    + T+SGTSMA+PH+AG+ AY+++L+           ++     A ++ + T  ++
Sbjct  333  GG--GSKTLSGTSMAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSI 379
Query  429  SDVPSNTANVLAWNG 443
            S  PS T + L +NG
Sbjct  380  SRAPSGTTSKLLYNG 394

Sequence Alignment: 12. Allergen Name: Asp v 13.0101 Sequence ID: ADE74975

 Score = 112.5 bits 466,  Expect = 4e-26
 Identities = 176/378 46%, Positives = 243/378 64%, Gaps = 40/378 10%
Query  29   APVLSSTSAKE-VPNSYMVVFKK--HVKDASKHHDWVQSVHSKNTQERMELRKRSSDLPV 85
            AP+L +    E VP  Y+V FK   + +    H  W  +VH +N  ER +L  R  DL  
Sbjct  21   APILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNL-ERRDLTDR--DL-- 75
Query  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
                + G++  +++  +  Y G FDD T+E IRNH DV ++E D +V  L  D   T+++
Sbjct  76   ----YPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYL--DALTTQSD 128
Query  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
            +PWGL  ISH+   S    + Y+Y    G     YV+DTG NVDH +F+GRA        
Sbjct  129  APWGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAG 184
Query  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
            G    D  GHGTH +GT+ GK +GV+KKA++ +VKV+    S T S ++ G  +AA   +
Sbjct  185  GQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAA---N 239
Query  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
            + VS ++ GK      S  N+SLGGG S  +  AV +A D G+   VAAGN+N D+ N S
Sbjct  240  DIVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTS 293
Query  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
            PA+A NA+TV AST  + RA FSNYG+  DIFAPG +ILS WIG   ATNTISGTSMA+P
Sbjct  294  PASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATP 353
Query  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443
            HI GL  Y+++L+            +P  + + +  + T GALS V S + N LA+NG
Sbjct  354  HIVGLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNG 401

Sequence Alignment: 13. Allergen Name: Asp f 13 Sequence ID: P28296

 Score = 107.5 bits 444,  Expect = 1e-24
 Identities = 169/378 44%, Positives = 235/378 62%, Gaps = 40/378 10%
Query  29   APVLSST-SAKEVPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNTQERMELRKRSSDLPV 85
            APV  +  +A+++P  Y+V FK     A+   H  W   +H +N + R      S + PV
Sbjct  21   APVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERR---DTTSGEPPV 77
Query  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
                  G++ +Y++  +  Y+G FDD T+E IR   DV ++E D ++  L  D   T+  
Sbjct  78   ------GIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEED-QIWYL--DALTTQKG 128
Query  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
            +PWGL  ISH+   S      Y+Y    G G   YV+D+G NV+HV+FE RA        
Sbjct  129  APWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAAG 184
Query  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
            G +  D  GHGTH +GT+ GK YGVAKK ++ +VKV++   S T S ++ G  +A    +
Sbjct  185  G-SHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST-SIILDGFNWAV---N 239
Query  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
            + VS  +  K      +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+D+ N S
Sbjct  240  DIVSKGRTKK------AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTS 293
Query  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
            PA+A NA+TV A    + RA FSNYG   DIFAPG +ILS WIGS  ATNTISGTSMA+P
Sbjct  294  PASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATP 353
Query  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443
            HI GL  Y++ L+     A   A I  K+L  N       G +++V   + N LA+NG
Sbjct  354  HIVGLSVYLMGLENLSGPAAVTARI--KELATN-------GVVTNV-KGSPNKLAYNG 401

Sequence Alignment: 14. Allergen Name: Asp fl protease Sequence ID: AAD47202

 Score = 101.8 bits 419,  Expect = 7e-23
 Identities = 171/378 45%, Positives = 241/378 63%, Gaps = 40/378 10%
Query  29   APVLSSTSAKE-VPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNTQERMELRKRSSDLPV 85
            APV  +  A E +P  Y+V FK  + +A   +H  W  ++H ++ + R        DLPV
Sbjct  21   APVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGAT---GGDLPV 77
Query  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
                  G++  Y+++ +  Y+G FDD T+E IR + DV Y+E D ++  L G    T+ +
Sbjct  78   ------GIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEED-QIYYLDGL--TTQKS 128
Query  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
            +PWGL  ISH+   S      Y+Y    GEG   YV+D+G NVDH +FEGRA        
Sbjct  129  APWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAG 184
Query  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
            G    D  GHGTH SGT+AGK YG+AKKA + +VKV++   S T S ++ G  +AA   +
Sbjct  185  GQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILDGFNWAA---N 239
Query  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
            + VS  +  K      +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+   S
Sbjct  240  DIVSKKRTSK------AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTS 293
Query  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
            PA+A +A+TV A    + RA FSN+GK  D+FAPG +ILS WIGS  ATNTISGTSMA+P
Sbjct  294  PASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATP 353
Query  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443
            HI GL  Y+ +L+   D   AV     K+++     + T   + DV   + N+LA+NG
Sbjct  354  HIVGLSLYLAALENL-DGPAAVT----KRIEE----LATKDVVKDV-KGSPNLLAYNG 401

Sequence Alignment: 15. Allergen Name: Asp o 13 Sequence ID: CAA35594

 Score = 101.8 bits 419,  Expect = 7e-23
 Identities = 172/378 45%, Positives = 241/378 63%, Gaps = 40/378 10%
Query  29   APVLSSTSAKE-VPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNTQERMELRKRSSDLPV 85
            APV  +  A E +P  Y+V FK  + +A   +H  W  ++H ++ + R        DLPV
Sbjct  21   APVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGAT---GGDLPV 77
Query  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
                  G++  Y+++ +  Y+G FDD T+E IR + DV Y+E D ++  L G    T+ +
Sbjct  78   ------GIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEED-QIYYLDGL--TTQKS 128
Query  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
            +PWGL  ISH+   S      Y+Y    GEG   YV+D+G NVDH +FEGRA        
Sbjct  129  APWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAG 184
Query  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
            G    D  GHGTH SGT+AGK YG+AKKA + +VKV++   S T S ++ G  +AA   +
Sbjct  185  GQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILDGFNWAA---N 239
Query  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
            + VS  +  K      +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+   S
Sbjct  240  DIVSKKRTSK------AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTS 293
Query  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
            PA+A +A+TV A    + RA FSN+GK  D+FAPG +ILS WIGS  ATNTISGTSMA+P
Sbjct  294  PASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATP 353
Query  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443
            HI GL  Y+ +L+   D   AV     K++K     + T   + DV   + N+LA+NG
Sbjct  354  HIVGLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDV-KGSPNLLAYNG 401

Sequence Alignment: 16. Allergen Name: Pen c 13.0101 Sequence ID: AAD25926

 Score = 83.8 bits 340,  Expect = 2e-17
 Identities = 166/388 42%, Positives = 245/388 63%, Gaps = 47/388 12%
Query  12   LAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDA--SKHHDWVQSVHSKN 69
            L   + +++T  +      + +S +   +P+SY+VV    V  A  + H +W  +VH+  
Sbjct  4    LKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFNTHREWATNVHA-- 61
Query  70   TQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERD 129
               R+  RK     P       G KH +E++GLKGY+  FD+ T + I N P V YIE D
Sbjct  62   ---RLSRRKNGETGP-------G-KH-FEINGLKGYTASFDESTAKDIANDPAVKYIEPD 109
Query  130  SEVRILGGDEPETENNSP-WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNV 188
                I+       ++N P WGLARIS + +   GT   Y Y +  GEGV  Y +DTG ++
Sbjct  110  ---MIVNATANVVQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDI 162
Query  189  DHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSG 248
             H DF GRAKWG  + + D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG
Sbjct  163  SHSDFGGRAKWGTNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSG 221
Query  249  TMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGL 308
            T S V+ G+++A K   +A S   NGK         NMSLGG  S  ++ A    V +G+
Sbjct  222  TNSGVISGMDWAVK---DAKSRGANGK------YVMNMSLGGEFSKAVNDAAANVVKSGI 272
Query  309  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWI 368
             ++VAAGN+  ++ N SPA+A    T+ AST  D  A F+N+G   D++APG +I + + 
Sbjct  273  FLSVAAGNEAENASNSSPASAAEVCTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYP 332
Query  369  GSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGAL 428
            G    + T+SGTSMA+PH+AG+ AY+++L+           ++     A ++ + T  ++
Sbjct  333  GG--GSKTLSGTSMAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSI 379
Query  429  SDVPSNTANVLAWNG 443
            S  PS T + L +NG
Sbjct  380  SRAPSGTTSKLLYNG 394

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.