The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA
LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV
EQEDVIPEDWKPDTVYKSKIQF
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL14078 Cyn d 1 262 1838 432.7 6.4e-123
AAL14079 Cyn d 1.0203 262 1760 414.6 1.7e-117
AAL14077 Cyn d 1.0202 262 1760 414.6 1.7e-117
A0A4D6FZ45 Uro m 1.0101 262 1760 414.6 1.7e-117
AAF80379 Cyn d 1.0204 244 1688 398.0 1.6e-112
AAK96255 Cyn d 1.0201 244 1683 396.8 3.6e-112
QCX36431 Zoy m 1.0101 272 1523 359.8 5.8e-101
O04701 Cyn d 1 246 1498 354.0 2.8e-99
CAA10520 Poa p a 263 1251 296.9 4.8e-82
CAA10140 Hol l 1 263 1246 295.7 1.1e-81
P43213 Phl p 1 263 1243 295.0 1.7e-81
A0A4D6G2J8 Uro m 1.0201 229 1230 292.1 1.2e-80
Q41260 Pha a 1 269 1223 290.4 4.4e-80
P43216 Hol l 1 265 1222 290.2 5.1e-80
CAA81613 Phl p 1.0101 263 1219 289.5 8.1e-80
AAF72983 Ory s 1 267 1213 288.1 2.2e-79
CAA93121 Hol l 1.0102 248 1207 286.7 5.1e-79
AAA63278 Lol p 1.0102 252 1205 286.3 7.2e-79
CAB63699 Lol p 1.0103 263 1203 285.8 1.1e-78
P14946 Lol p 1 263 1195 283.9 3.8e-78
AAA63279 Lol p 1.0101 263 1192 283.2 6.2e-78
AAF72991 Ory s 1 267 1184 281.4 2.3e-77
ACA23876 Pas n 1.0101 265 1153 274.2 3.2e-75
P58738 Zea m 1 269 1121 266.8 5.6e-73
AAF72990 Ory s 1 269 1103 262.6 1e-71
ABC58726 Sor h 1.0101 239 1100 262.0 1.4e-71
Q40638 Ory s 1 263 1037 247.4 3.8e-67
AAF72984 Ory s 1 268 941 225.2 1.9e-60
AAF72987 Ory s 1 275 923 221.0 3.5e-59
Q07154 Zea m 1 191 882 211.7 1.5e-56
AAB61710 Ory s 1 261 882 211.5 2.4e-56
AAD10496 Tri a ps93 271 860 206.4 8.4e-55
AAF72989 Ory s 1 271 851 204.3 3.6e-54
AAF72985 Ory s 1 286 847 203.4 7.3e-54
AAF72988 Ory s 1 327 711 171.8 2.6e-44
AAA50175 Gly m 2 277 688 166.6 8.2e-43
AAF72986 Ory s 1 275 679 164.5 3.4e-42
CAB37496 Ara t expansin 265 396 99.1 1.7e-22
AAG13596 Ory s 1 275 345 87.3 6.2e-19
BAA85432 Ory s 1 284 315 80.3 8e-17
AAP80171 Cyn d 15 112 260 68.1 1.5e-13
P14947 Lol p 2 97 236 62.6 5.8e-12
CAA10346 Cyn d 2 122 237 62.7 6.7e-12
CAA10348 Poa p 2 122 233 61.8 1.3e-11
P43214 Phl p 2 122 233 61.8 1.3e-11
CAA10345 Dac g 2 122 233 61.8 1.3e-11
CAA51775 Lol p 2 88 216 58.1 1.2e-10
P93124 Dac g 3 96 209 56.4 4.3e-10
2JNZ_A Phl p 3.0101 108 197 53.6 3.5e-09
Q7M1X8 Dac g 1.0101 34 167 47.2 8.7e-08
P14948 Lol p 3 97 171 47.6 1.9e-07
A0A077B7S9 Sor h 2.0101 119 172 47.7 2.2e-07
Q7M1X6 Ant o 1.0101 32 157 45.0 4e-07
A0A077B2S0 Sor h 2.0201 121 168 46.8 4.3e-07
CAA90746 Tri a 3 118 166 46.3 5.7e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 432.7 bits 1838,  Expect = 6e-123
 Identities = 262/262 100%, Positives = 262/262 100%, Gaps = 0/262 0%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 2. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 414.6 bits 1760,  Expect = 2e-117
 Identities = 252/262 96%, Positives = 254/262 96%, Gaps = 0/262 0%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLA VAVVLASMVGGA CAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFD MTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGS+PNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIV VDIK KGSD FLPMK SWGAIWR+DPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 3. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 414.6 bits 1760,  Expect = 2e-117
 Identities = 252/262 96%, Positives = 254/262 96%, Gaps = 0/262 0%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLA VAVVLASMVGGA CAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFDGMTGCGNEPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGS+PNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIV VDIK KGSD FLPMK SWGAIWR+DPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 4. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 414.6 bits 1760,  Expect = 2e-117
 Identities = 252/262 96%, Positives = 254/262 96%, Gaps = 0/262 0%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLA VAVVLASMVGGA CAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFD MTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGS+PNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIV VDIK KGSD FLPMK SWGAIWR+DPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 5. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 398.0 bits 1688,  Expect = 2e-112
 Identities = 239/244 97%, Positives = 240/244 98%, Gaps = 0/244 0%
Query  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
            EPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  139  EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 198
            EEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGSSPNYLALLVKYAAGDGNIVGVDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  199  PKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
            PKGSD FLPMK SWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  259  KIQF 262
            KIQF
Sbjct  241  KIQF 244

Sequence Alignment: 6. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 396.8 bits 1683,  Expect = 4e-112
 Identities = 238/244 97%, Positives = 240/244 98%, Gaps = 0/244 0%
Query  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
            EPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  139  EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 198
            EEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGSSPNYLALLVKYAAGDGNIVGVDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  199  PKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
            PKGSD FLPMK SWGAIWR+DPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  181  PKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  259  KIQF 262
            KIQF
Sbjct  241  KIQF 244

Sequence Alignment: 7. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 359.8 bits 1523,  Expect = 6e-101
 Identities = 214/261 81%, Positives = 237/261 90%, Gaps = 0/261 0%
Query  2    LAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
            LAAVAV+L++MVG A C +GDKPGPNITATY ++W DAKATFYGS+PRGAAPDD GGACG
Sbjct  12   LAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACG 71
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
            YK+VDKAPF GMTGCGNEPIFKDGLGCGSC+EIKCKEPAECS +PVLI+ITDKNYEHIAA
Sbjct  72   YKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAA 131
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLAL 181
            YHFDLSGKAFG+MAK+G+ED LRKAGEL LQFRRVKCEYPS TKITFHVEKG + NYLAL
Sbjct  132  YHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLAL 191
Query  182  LVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVE 241
            LV+YAAGDG+IV VDIKPKGSD FLPMK SWGAIWR+DP KPLKGPFT+RLTSESG  + 
Sbjct  192  LVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLV 251
Query  242  QEDVIPEDWKPDTVYKSKIQF 262
            QEDVIP DWKP+T Y S +Q+
Sbjct  252  QEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 8. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 354.0 bits 1498,  Expect = 3e-99
 Identities = 207/244 84%, Positives = 226/244 92%, Gaps = 0/244 0%
Query  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
Query  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
            EPIFKDGLGC +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  139  EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 198
            +EDKLRKAGEL LQFRRVKC+YPS TKITFH+EKGS+ +YLALLVKYAAGDGNIV VDIK
Sbjct  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
Query  199  PKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
            P+ SD F+PMK SWGAIWR+DP KPLKGPF+IRLTSE G H+ Q+DVIP +WKPDTVY S
Sbjct  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
Query  259  KIQF 262
            K+QF
Sbjct  241  KLQF 244

Sequence Alignment: 9. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 296.9 bits 1251,  Expect = 5e-82
 Identities = 179/254 70%, Positives = 200/254 78%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V  ++A  +G A       PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYKD
Sbjct  10   VVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKD 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDKAPF GMTGCGN PIFK G GCGSC+EIKC +P  CSGEPVL+ ITD N E IAAYHF
Sbjct  69   VDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEPIAAYHF 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSGKAFGAMAKKGEE KLR AGEL L+FRRVKCEYP  TK+TFHVEKGS+PNYLALLVK
Sbjct  129  DLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            Y  GDG++V VDIK KG D ++ +K SWG+IWR+D P  L GPFT+R T+E G   E ED
Sbjct  189  YVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAED 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y SK
Sbjct  249  VIPEGWKADTAYASK 263

Sequence Alignment: 10. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 295.7 bits 1246,  Expect = 1e-81
 Identities = 176/254 69%, Positives = 201/254 79%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V  ++A  +G A       PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYKD
Sbjct  10   VVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKD 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDK PF GMTGCGN PIFK G GCGSC+EIKC +P  CSGEP+++ ITD N E IAAYH+
Sbjct  69   VDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIAAYHL 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSGKAFGAMAKKGEE KLR AGEL L+FRRVKCEYP  TK+TFHVEKGS+PNYLALLVK
Sbjct  129  DLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            Y  GDG++V VDIK KG D ++ +K SWGA+WR+D P  L GPFT+R T+E G  VE ED
Sbjct  189  YVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAED 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y+SK
Sbjct  249  VIPEGWKADTAYESK 263

Sequence Alignment: 11. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 295.0 bits 1243,  Expect = 2e-81
 Identities = 176/254 69%, Positives = 200/254 78%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V V++A  +G A+      PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYKD
Sbjct  10   VVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKD 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDK PF GMTGCGN PIFK G GCGSC+EIKC +P  CSGEPV++ ITD N E IA YHF
Sbjct  69   VDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHF 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSG AFGAMAKKG+E KLR AGEL LQFRRVKC+YP  TK+TFHVEKGS+PNYLALLVK
Sbjct  129  DLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            Y  GDG++V VDIK KG D ++ +K SWGAIWR+D P  L GPFT+R T+E G   E ED
Sbjct  189  YVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAED 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y+SK
Sbjct  249  VIPEGWKADTSYESK 263

Sequence Alignment: 12. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 292.1 bits 1230,  Expect = 1e-80
 Identities = 169/227 74%, Positives = 197/227 86%, Gaps = 1/227 0%
Query  35   KWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEI 94
            KWLDAKAT+YG  P GA PDD+GGACGYKDV+KAPF+ M  CGN PIFKDGLGCGSCYEI
Sbjct  3    KWLDAKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  95   KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFR 154
            KC +PAECSGEPV++ ITD+NYE IAAYHFDL+G AFGAMAKKGEE+KLRKAG + +QFR
Sbjct  62   KCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFR 121
Query  155  RVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGA 214
            RVKC+YP++TKI FHVEKG +PNY+ALL+KYAAGDG+IV VDIK KGS+ F+P+K SWGA
Sbjct  122  RVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGA 181
Query  215  IWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            IWR+D PKP+KGP  +RLTSE G  + Q+D IPE WK DTVY SK+QF
Sbjct  182  IWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 13. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 290.4 bits 1223,  Expect = 4e-80
 Identities = 175/257 68%, Positives = 198/257 77%, Gaps = 1/257 0%
Query  2    LAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
            L  VA +LA  VG A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACG
Sbjct  13   LLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACG 71
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
            YKDVDKAPF+GMTGCGN PIFKDG GCGSC+E+KC +P  CSGEP+ + ITD N E IA 
Sbjct  72   YKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEEPIAP 131
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLAL 181
            YHFDLSG AFG+MAKKGEE+ +R AGEL LQFRRVKC+YP  TK TFHVEKGS+PNYLAL
Sbjct  132  YHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLAL 191
Query  182  LVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVE 241
            LVKY  GDG++V VDIK KG D ++ +K SWGAIWR+D P  L GPFT+R T+E G   E
Sbjct  192  LVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAE 251
Query  242  QEDVIPEDWKPDTVYKSK 259
             EDVIPE WK DT   SK
Sbjct  252  FEDVIPEGWKADTHDASK 269

Sequence Alignment: 14. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 290.2 bits 1222,  Expect = 5e-80
 Identities = 174/258 67%, Positives = 200/258 77%, Gaps = 1/258 0%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L  VA ++A  +G A       PGPNITATYGD+WLDAK+T+YG  P GA P D+GGAC
Sbjct  8    VLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGAC 66
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDK PF GMTGCGN PIFKDG GCGSC+EIKC +P  CSGEPV + ITD N E IA
Sbjct  67   GYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIA 126
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
             YHFDLSG AFG+MAKKGEE KLR AGEL L+FRRVKC+YP  TK TFHVEKGS+PNYLA
Sbjct  127  PYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLA 186
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            LLVKY  GDG++V VDIK KG D ++ +K SWGA+WR+D P  L GPFT+R T+E G   
Sbjct  187  LLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKG 246
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y++K
Sbjct  247  EAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 15. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 289.5 bits 1219,  Expect = 8e-80
 Identities = 172/254 67%, Positives = 201/254 79%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V  ++A  +G A       PGPNITATYGDKWLDAK+T+YG  P  A P D+GGACGYKD
Sbjct  10   VVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGK-PTAAGPKDNGGACGYKD 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDK PF GMTGCGN PIFK G GCGSC+EIKC +P  CSGEPV++ ITD N E IAAYHF
Sbjct  69   VDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHF 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSG AFG+MAKKG+E KLR AGE+ +QFRRVKC+YP  TK+TFHVEKGS+PNYLALLVK
Sbjct  129  DLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            + AGDG++V VDIK KG D ++ +K SWGAIWR+D P+ LKGPFT+R T+E G   E +D
Sbjct  189  FVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKD 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y+SK
Sbjct  249  VIPEGWKADTAYESK 263

Sequence Alignment: 16. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 288.1 bits 1213,  Expect = 2e-79
 Identities = 169/254 66%, Positives = 206/254 81%, Gaps = 2/254 0%
Query  7    VVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDV 65
            VV+A+MV    C      PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGACGYKDV
Sbjct  11   VVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDV 69
Query  66   DKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFD 125
            DKAPF GM  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IAAYHFD
Sbjct  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFD 129
Query  126  LSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKY 185
            LSG AFGAMAK G++++LRKAG +  QFRRVKC+YP+DTKITFH+EK S+PNYLALLVKY
Sbjct  130  LSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKY 189
Query  186  AAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV 245
             AGDG++V V+IK KGS+ +  +K SWGAIWR+D PKPLKGPF++R+T+E G  +  ED 
Sbjct  190  VAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA 249
Query  246  IPEDWKPDTVYKSKIQ 261
            IP+ WK D+VYKS +Q
Sbjct  250  IPDGWKADSVYKSNVQ 265

Sequence Alignment: 17. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 286.7 bits 1207,  Expect = 5e-79
 Identities = 168/235 71%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  24   PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 83
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
Query  84   DGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 143
            DG GCGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
Query  144  RKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 203
            R AGEL L+FRRVKC+YP  TK TFHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
Query  204  VFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259
             ++ +K SWGA+WR+D P  L GPFT+R T+E G   E EDVIPE WK DT Y++K
Sbjct  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248

Sequence Alignment: 18. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 286.3 bits 1205,  Expect = 7e-79
 Identities = 170/251 67%, Positives = 195/251 77%, Gaps = 1/251 0%
Query  8    VLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDK 67
            ++A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKDVDK
Sbjct  2    LFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDK 60
Query  68   APFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLS 127
            APF+GMTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA YHFDLS
Sbjct  61   APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS 120
Query  128  GKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAA 187
            G AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK TFHVEKGS+PNYLA+LVKY  
Sbjct  121  GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVD 180
Query  188  GDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIP 247
            GDG++V VDIK KG D ++ +K SWGA+WR+D P  L GPFT+R T+E G   E EDVIP
Sbjct  181  GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP 240
Query  248  EDWKPDTVYKSK 259
            E WK DT Y +K
Sbjct  241  EGWKADTSYSAK 252

Sequence Alignment: 19. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 285.8 bits 1203,  Expect = 1e-78
 Identities = 171/254 67%, Positives = 195/254 76%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V  ++A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKD
Sbjct  10   VVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKD 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDKAPF+GMTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA YHF
Sbjct  69   VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHF 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSG AFG+MAKKGEE KLR AGEL LQFRRVKC+YP  TK TFHVEK S+PNYLA+LVK
Sbjct  129  DLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            Y  GDG++V VDIK KG D ++ +K SWGA+WR+D P  L GPFT+R T+E G   E ED
Sbjct  189  YVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVED 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y +K
Sbjct  249  VIPEGWKADTSYSAK 263

Sequence Alignment: 20. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 283.9 bits 1195,  Expect = 4e-78
 Identities = 169/254 66%, Positives = 195/254 76%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V  ++A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+
Sbjct  10   VVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKN 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDKAPF+GMTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA YHF
Sbjct  69   VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHF 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK TFHVEK S+PNYLA+LVK
Sbjct  129  DLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            Y  GDG++V VDIK KG D ++ +K SWGA+WR+D P  L GPFT+R T+E G   E ED
Sbjct  189  YVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFED 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y +K
Sbjct  249  VIPEGWKADTSYSAK 263

Sequence Alignment: 21. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 283.2 bits 1192,  Expect = 6e-78
 Identities = 169/254 66%, Positives = 194/254 76%, Gaps = 1/254 0%
Query  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
            V  ++A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+
Sbjct  10   VVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKN 68
Query  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
            VDKAPF+GMTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA YHF
Sbjct  69   VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHF 128
Query  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
            DLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK TFHVEK S+PNYLA+LVK
Sbjct  129  DLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVK 188
Query  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
            Y  GDG++V VDIK KG D +  +K SWGA+WR+D P  L GPFT+R T+E G   E ED
Sbjct  189  YVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFED 248
Query  245  VIPEDWKPDTVYKSK 259
            VIPE WK DT Y +K
Sbjct  249  VIPEGWKADTSYSAK 263

Sequence Alignment: 22. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 281.4 bits 1184,  Expect = 2e-77
 Identities = 160/254 62%, Positives = 206/254 81%, Gaps = 2/254 0%
Query  7    VVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDV 65
            VV A+MV    C      PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGACGYKD+
Sbjct  11   VVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDI 69
Query  66   DKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFD 125
            DKAPF GM  CGN+PIFKDG GCGSC+E+KC +P  CS +PV+I ITD N E IAAYHFD
Sbjct  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFD 129
Query  126  LSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKY 185
            LSG AFGAMAK+G++++LRKAG + +QFRRV+C+YP +TK+TFHVEKGS+PNY+A+LVKY
Sbjct  130  LSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKY 189
Query  186  AAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV 245
              GDG++V V++K KGS+ + P+  SWGAIWR+D PKPLKGPF++R+T+ES   +   DV
Sbjct  190  VGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV 249
Query  246  IPEDWKPDTVYKSKIQ 261
            IP++WK + +YKS+IQ
Sbjct  250  IPDNWKANALYKSEIQ 265

Sequence Alignment: 23. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 274.2 bits 1153,  Expect = 3e-75
 Identities = 169/258 65%, Positives = 198/258 76%, Gaps = 4/258 1%
Query  2    LAAVAVVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            + AVA VLA++V G  C      PGPNIT  Y  KWL AKAT+YG  P GA PDD+GGAC
Sbjct  7    IVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQ-PNGAGPDDNGGAC 65
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            G K+V+  P++G T CGN PIFKDG GCGSCYEI+C +P ECSG+PV + ITD NYE IA
Sbjct  66   GIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKP-ECSGQPVTVFITDMNYEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
             YHFDLSGKAFGAMAK G  DKLR  G + L+FRRV+C+Y    KI FHVEKGS+PNYLA
Sbjct  125  PYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLA 184
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            +LVK+ A DG+IV +++K K SD + PMKLSWGAIWRMD PK L  PF+IRLTSESG  V
Sbjct  185  MLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKV 243
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
              +DVIP +WKPDTVY S +QF
Sbjct  244  IAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 24. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 266.8 bits 1121,  Expect = 6e-73
 Identities = 159/260 61%, Positives = 193/260 74%, Gaps = 2/260 0%
Query  2    LAAVAVVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +  V  VLA++V G  C      PGPNIT  Y  KWL A+AT+YG  P GA   D+GGAC
Sbjct  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            G K+V+  P+ GMT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA
Sbjct  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
             YHFDLSGKAFG++AK G  DK+R  G + ++FRRV+C+YP+  KI FH+EKG +PNYLA
Sbjct  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
Query  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
            +LVKY A DG+IV ++I+ K S  + PMKLSWGAIWRMD  K LKGPF+IRLTSESG  V
Sbjct  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
              +DVIP +W+PD VY S +QF
Sbjct  247  IAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 25. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 262.6 bits 1103,  Expect = 1e-71
 Identities = 154/260 59%, Positives = 198/260 76%, Gaps = 3/260 1%
Query  1    MLAAVAVVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
            ++ AVAVV A++VGG  C      PGPNIT  Y   WL A+AT+YG  P G+   D+GGA
Sbjct  8    IVLAVAVV-AALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGA 65
Query  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
            CG K+V+  P++GM  CGN PIFKDG GCGSCYE+KC++PA CS +PV + ITD NYE I
Sbjct  66   CGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPI 125
Query  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYL 179
            +AYHFD+SGKAFGAMA  G+E +LRKAG + +QFRRV+C+YP   K+TFHVEKGS+PNYL
Sbjct  126  SAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYL 185
Query  180  ALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGH 239
            A+LVK+ A DG+++ +D++  G   + PMKLSWGAIWRMD   PLK PF+IR+T+ESG  
Sbjct  186  AVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKS 245
Query  240  VEQEDVIPEDWKPDTVYKSKIQF 262
            +  +DVIP +W PD +Y S +QF
Sbjct  246  LIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 26. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 262.0 bits 1100,  Expect = 1e-71
 Identities = 158/231 68%, Positives = 187/231 80%, Gaps = 6/231 2%
Query  25   GPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKD 84
            G NIT TYG  WL+ KAT+YG  P GA PDD+GGACGYKDV+KAPF+ M  CGN PIFKD
Sbjct  7    GKNITETYGSDWLERKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKD 65
Query  85   GLGCGSCYEIKCKEP--AECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDK 142
            GL CGSC+EIKC +P  AECSGE V++ ITD NYE+IAAYHFDL+G AFGAMAKKG+E+K
Sbjct  66   GL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEK 124
Query  143  LRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGS 202
            L KAG + ++FRRVKC+Y    K+TFHVEKGS+PNYLALLVKY  GDG+IVGVDIK KG 
Sbjct  125  LAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGG 182
Query  203  DVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259
            D + P+K SWGAIWR D P P+K P T+++T+E G     +DVIPE WK DT Y +K
Sbjct  183  DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 247.4 bits 1037,  Expect = 4e-67
 Identities = 151/238 63%, Positives = 184/238 77%, Gaps = 5/238 2%
Query  7    VVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDV 65
            VV+A+MV  +        PGPNIT +YGDKWL+A+       PR  AP D+GGACGYKDV
Sbjct  11   VVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDV 69
Query  66   DKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFD 125
            DKAPF GM  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IAAYHFD
Sbjct  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFD 129
Query  126  LSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKY 185
            LSG A   MAK G++++LRKAG +  QFRRVKC+YP+DTKITFH+EK S+PNYLALLVKY
Sbjct  130  LSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKY 186
Query  186  AAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV 245
             AGDG++V V+IK KGS+ +  +K SWGAIWR+D PKPLKGPF++R+T+E       ED 
Sbjct  187  VAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDA 246
Query  246  IPE 248
            IP+
Sbjct  247  IPD 249

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 225.2 bits 941,  Expect = 2e-60
 Identities = 134/255 52%, Positives = 181/255 70%, Gaps = 8/255 3%
Query  3    AAVAVVLASMVGGAWCAMGDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
            AAVA +++ +V    C  G +PG N +A   T    W  A+AT+YG+ P GA PDD GGA
Sbjct  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
Query  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
            CG+K+ ++ PF  MT CGNEPIFKDG GCGSCY+I+C     CSG P  + ITD NY  +
Sbjct  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
Query  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYL 179
            + YHFDLSG AFGAMAK G+ D+LR AG + +QF+RV C +P   K+TFHVE+GS+P Y+
Sbjct  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
Query  180  ALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGH 239
            A+LV+Y  GDG++V VD+    S  + PM+ SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
Query  240  VEQEDVIPEDWKPDTVYKSKIQF 262
            +    VIP +W P  VY+S +Q+
Sbjct  244  LVASQVIPANWAPMAVYRSFVQY 266

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 221.0 bits 923,  Expect = 4e-59
 Identities = 134/258 51%, Positives = 182/258 70%, Gaps = 11/258 4%
Query  2    LAAVAVVLASMVGGAWCAMGDKPGPNIT--ATYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
            +AA+  +L+ +V    C  G     N++  + YG  WL A+AT+YG+ P GA PDD+GGA
Sbjct  9    VAAILAILSVLVVHGSCK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAGPDDNGGA 66
Query  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
            CG+K+V++ PF  MT CGNEPIFKDG GCGSCY+I+C +   CSG    + ITD NY  +
Sbjct  67   CGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPV 126
Query  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYL 179
            A YHFDLSG AFGAMAK G  DKLR +G + +QFRRV C YP   KI FHVE+GS+P Y+
Sbjct  127  ARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYF 185
Query  180  ALLVKYAAGDGNIVGVDIKPKGS------DVFLPMKLSWGAIWRMDPPKPLKGPFTIRLT 233
            A+LV+Y   DG++V VD+    S       V+ PM+ SWG+IWR+D    L+ PF++R+ 
Sbjct  186  AVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIR 245
Query  234  SESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            S+SG  +   +VIP +W P++ Y+S +QF
Sbjct  246  SDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 30. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 211.7 bits 882,  Expect = 2e-56
 Identities = 122/190 64%, Positives = 149/190 78%, Gaps = 0/190 0%
Query  73   MTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 132
            MT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  133  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNI 192
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG +PNY+A+LVK+ A DG+I
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  193  VGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKP 252
            V ++I+ K S  + PMKLSWGAIWRMD  K LKGPF+IRLTSESG  V  +D+IP +W+P
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  253  DTVYKSKIQF 262
            D VY S +QF
Sbjct  181  DAVYTSNVQF 190

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 211.5 bits 882,  Expect = 2e-56
 Identities = 132/255 51%, Positives = 174/255 68%, Gaps = 12/255 4%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            M  A A V+A M+       G   G      Y + WL AKAT+YG  P GA PDD+GGAC
Sbjct  1    MAGASAKVVA-MLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGAC 54
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            G+K+ ++ PF  MT CGNEP+F+DG GCG+CY+I+C     CSG+P  + ITD NY  +A
Sbjct  55   GFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVA 114
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
             YHFDLSG AFGAMA+ G  D+LR AG + +QFRRV C Y     + FHVE GS+P YLA
Sbjct  115  RYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLA 173
Query  181  LLVKYAAGDGNIVGVDIK---PKG--SDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSE 235
            +LV++A  DG +V +D+    P G  + V+ PM+ SWG+IWR+D    L+GP ++R+ SE
Sbjct  174  VLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSE 233
Query  236  SGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            SG  V    VIP +W+ +T Y SK+QF
Sbjct  234  SGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 32. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 206.4 bits 860,  Expect = 8e-55
 Identities = 123/230 53%, Positives = 168/230 73%, Gaps = 14/230 6%
Query  28   ITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLG 87
            +  +Y   WL AKAT+YG+ P GA PDD+GGACG+K+V++ P   M  CGNEPIF  G G
Sbjct  32   VARSYTSGWLPAKATWYGA-PNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEG 90
Query  88   CGSCYEIKCK---EPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLR 144
            CG CYEIKC+    P+ CSG+P  I ITD NY  +A YH+DLSG AFG+MAK G  D+LR
Sbjct  91   CGMCYEIKCEYSNNPS-CSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLR 149
Query  145  KAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDI------K 198
             AG + +QFRRV C +P   K+TFHV++GS+PNYLA+LV+Y   DG +V +++      +
Sbjct  150  HAGIIDMQFRRVPCNFPG-MKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGR 208
Query  199  PKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
            P G   +  M+ SWG++WRMD  +P++GPF+IR+TS++G  +   + IP  W+ D  Y S
Sbjct  209  PTG--YWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWS 266
Query  259  KIQF 262
             +QF
Sbjct  267  NLQF 270

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 204.3 bits 851,  Expect = 4e-54
 Identities = 117/225 52%, Positives = 159/225 70%, Gaps = 4/225 1%
Query  36   WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIK 95
            W +AKAT+YG  P GA   D+GGACG+K V++ PF GMT CGN+P++K G GCGSCY ++
Sbjct  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
Query  96   CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR 155
            C     CSG    + ITD NY  ++ YHFDLSG AFG +AK G  D LR+AG + +QF R
Sbjct  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
Query  156  VKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD--VFLPMKLSWG 213
            V CE+P   K+ FHVE+GSSP YLA+LV+Y  GDG++  VD+K  G+    + PM+ SWG
Sbjct  162  VPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
Query  214  AIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            ++WR+D    L+ PF+IR+ S+SG  +   DVIP +W P+T Y+S +Q+
Sbjct  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 203.4 bits 847,  Expect = 7e-54
 Identities = 123/244 50%, Positives = 168/244 68%, Gaps = 17/244 6%
Query  10   ASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAP 69
            A   G  W    D    +  A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ P
Sbjct  34   ADFAGNGW----DFNSSD-AAVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYP 87
Query  70   FDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGK 129
            F  MT CGN+P+FKDG GCGSCY+I+C +   CSG    + ITD NY  +A +HFDLSG 
Sbjct  88   FMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGT 147
Query  130  AFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGD 189
            AFG +AK G  DKLR +G + ++F RV CE+P   KI FHVE+ S+P Y+A+LV+Y  GD
Sbjct  148  AFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGD 206
Query  190  GNIVGVDI--------KPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVE 241
            G++V VD+         P G   + PM+ SWG+IWR+D    L+ PF+IR+ +ESG  + 
Sbjct  207  GDVVQVDLMESKTAHGPPTGK--WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLV 264
Query  242  QEDVIPEDWKPDTVYKSKIQF 262
              +VIP +W+P+T Y+S +Q+
Sbjct  265  ANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 171.8 bits 711,  Expect = 3e-44
 Identities = 133/226 58%, Positives = 173/226 76%, Gaps = 16/226 7%
Query  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCY 92
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG GCGSCY
Sbjct  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
Query  93   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 152
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
Query  153  FRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIV------------GVDIKPK 200
            FRRV C+YP  T +TFHVE+GS+P Y+A+LV+Y  GDG++V            GVD  P 
Sbjct  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
Query  201  GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKI 260
            G  V+ PM+ SWG+IWR+D   PL+GPF++R+T+ESG  +  + VIP DW+P+TVY S +
Sbjct  267  G--VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIV 324
Query  261  QF 262
            QF
Sbjct  325  QF 326

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 166.6 bits 688,  Expect = 8e-43
 Identities = 110/255 43%, Positives = 157/255 61%, Gaps = 16/255 6%
Query  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATY----GDKWLDAKATFYGSDPRGAAPDDH 56
            +L  +A++   +V  ++C     P     A+Y       W  A AT+YG  P        
Sbjct  12   LLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG--P-ANGDGSE 65
Query  57   GGACGYKD-VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK- 114
            GGACGY + V + PF  +   G+  I+  G GCGSCYE+KC   + CSG PV + ITD+ 
Sbjct  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
Query  115  -NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKG 173
                  A YHFDLSG AFGAMA  G+++ LR AG++ +Q RR++C YP  + I FHV+ G
Sbjct  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
Query  174  SSPNYLALLVKYAAGDGNIVGVDIKPK-GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRL 232
            S+  Y+A LV+Y  GDG++  V++K    S  +  M+ SWGA+W+ D   PL+ PF+I+L
Sbjct  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
Query  233  TS-ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            T+ ESG  +   +VIP  W P   Y+S + F
Sbjct  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 164.5 bits 679,  Expect = 3e-42
 Identities = 106/225 47%, Positives = 143/225 63%, Gaps = 12/225 5%
Query  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLGCGSC 91
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G GCGSC
Sbjct  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
Query  92   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 148
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
Query  149  LMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDI-KPKGSDVFLP 207
            L +Q++RV C +  +  + F V+ GS+P YLA+LV+YA GDG++  V I K +G   +  
Sbjct  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
Query  208  MKLSWGAIWRMDPP--KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            M+ SWGA WR++    KPL  PF+IRLTS SG  +   +VIP  W+    Y+S + +
Sbjct  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 99.1 bits 396,  Expect = 2e-22
 Identities = 77/224 34%, Positives = 119/224 53%, Gaps = 15/224 6%
Query  29   TATYGDKWL-DAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLG 87
            +A   D+ L  +KA ++ S     A     GAC Y  +    F G        I+KDG G
Sbjct  18   SAAACDRCLHSSKAAYFSS-----ASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSG 72
Query  88   CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKK--GEEDKLRK 145
            CG+C++++CK P  CS +   + +TD N  +     + LS +AF AMAK   G +  L K
Sbjct  73   CGACFQVRCKNPTLCSSKGTTVIVTDLNKTNQT--DLVLSSRAFRAMAKPVVGADRDLLK 130
Query  146  AGELMLQFRRVKCEYPSDTKITFHVEKGS-SPNYLALLVKYAAGDGNIVGVDIKPKGSDV 204
             G + +++RRV C+Y  + K+   VE+ S +PNYLA+ + Y  G   +V + I   GS  
Sbjct  131  QGIVDIEYRRVPCDY-GNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH 189
Query  205  FLPMKLSWGAIWRMD--PPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQ 261
            +  M  S GA+W  D  P   L+  F +      G  V  + V+P +W+    Y + +Q
Sbjct  190  WSYMTRSHGAVWVTDKVPNGALQFRFVVT-AGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 87.3 bits 345,  Expect = 6e-19
 Identities = 63/202 31%, Positives = 103/202 50%, Gaps = 10/202 4%
Query  56   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK 114
            + G+CGY  +  A F+G       P +F+ G+GCG+C++++CK+   CS     + +TD+
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
Query  115  NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVE-KG 173
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
Query  174  SSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWR--MDPPKPLKGPFTIR 231
              P  L++   Y  G  +IV VD+   GS  +  M   +G  W     P  PL+  F + 
Sbjct  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
Query  232  LTSESGGHVEQED--VIPEDWKPDTVYKSKIQ 261
            +T    G     D  V+P  W    VY + +Q
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 80.3 bits 315,  Expect = 8e-17
 Identities = 80/249 32%, Positives = 126/249 50%, Gaps = 36/249 14%
Query  1    MLAAVAVVLASMVGGAWCAMG----DKPGPNITATYGDK-WLDAKATFYGSDPRGAAPDD 55
            + AA+AV  A+ V  A          +P P     Y    W D  ATFYG DP G   DD
Sbjct  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DD 69
Query  56   HGGACGYKDVDKAP-FDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECS-GEP-VLIKIT 112
             GGACGY   D    +   T   + P+F DG GCG CYE++C +   C+ G P V+I  T
Sbjct  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
Query  113  ------------DKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY 160
                        D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+ 
Sbjct  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
Query  161  PSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD-VFLPMKLSWGAIWRMD 219
                +  +   +G+   +L L V    G G++  + +K  G    ++    +WG  +++ 
Sbjct  183  TGGVRFCL---QGNH-YWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
Query  220  PPKPLKGPFTIRLTSESGGH--VEQEDVIPEDWKPDTVYKSKIQF 262
                    +T++LT+ S  +  +   D I   W     Y+    F
Sbjct  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283

Sequence Alignment: 41. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 68.1 bits 260,  Expect = 2e-13
 Identities = 47/90 52%, Positives = 63/90 70%, Gaps = 7/90 7%
Query  166  ITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLK 225
            I FHVE+ SSP + AL +K +A +  I  VD++  G+D   PM  S G  W +D  KPLK
Sbjct  22   IIFHVEE-SSPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  226  GPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            GP+ IRL +E GG   Q+DVIPE+WK  T Y +K++F
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 42. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 62.6 bits 236,  Expect = 6e-12
 Identities = 37/92 40%, Positives = 53/92 57%, Gaps = 0/92 0%
Query  166  ITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLK 225
            + F VEKGS    LAL +KY     ++  V++K  GS+ +L +K +   +W +   KPLK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  226  GPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257
            GPF  R+ SE G     +DV+P D+K  T YK
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 43. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 62.7 bits 237,  Expect = 7e-12
 Identities = 38/90 42%, Positives = 55/90 61%, Gaps = 2/90 2%
Query  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
            K+TF VEKGS+  +LA+LVKY  GD  +  V+++  GSD ++ M    G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            KGPF  R+ +E G     +DV+PE +     Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 61.8 bits 233,  Expect = 1e-11
 Identities = 37/90 41%, Positives = 55/90 61%, Gaps = 2/90 2%
Query  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
            K+TF VEKGS+  +LA+LVKY  GD  +  V+++  GSD ++ M    G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            +GPF  R+ +E G     +DV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 61.8 bits 233,  Expect = 1e-11
 Identities = 37/90 41%, Positives = 55/90 61%, Gaps = 2/90 2%
Query  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
            K+TF VEKGS+  +LA+LVKY  GD  +  V+++  GSD ++ M    G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            +GPF  R+ +E G     +DV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 61.8 bits 233,  Expect = 1e-11
 Identities = 37/90 41%, Positives = 55/90 61%, Gaps = 2/90 2%
Query  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
            K+TF VEKGS+  +LA+LVKY  GD  +  V+++  GSD ++ M    G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            +GPF  R+ +E G     +DV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 58.1 bits 216,  Expect = 1e-10
 Identities = 35/87 40%, Positives = 50/87 57%, Gaps = 0/87 0%
Query  168  FHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGP 227
            F VEKGS    LAL +KY+     +  V++K  GS+ +L +K +   +W +   KPLKGP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  228  FTIRLTSESGGHVEQEDVIPEDWKPDT 254
            F  R+ SE G     +DV+P D+K  T
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 56.4 bits 209,  Expect = 4e-10
 Identities = 34/91 37%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
            K+TF VEKGS P  L L +KY      +  V+++  GS+ + P+    G +W +   KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLT-KKGNLWEVKSSKPL 60
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
             GPF  R+ S+ G     ++VIP  +K  T Y
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 49. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 53.6 bits 197,  Expect = 3e-09
 Identities = 32/95 33%, Positives = 51/95 53%, Gaps = 1/95 1%
Query  162  SDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPP 221
            S  ++TF V+KGS P  L L +KY     ++  V+++  GS+ + P+    G +W +   
Sbjct  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLT-KKGNVWEVKSS 69
Query  222  KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257
            KPL GPF  R+ S+ G     ++VIP  +     YK
Sbjct  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 50. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 47.2 bits 167,  Expect = 9e-08
 Identities = 24/29 82%, Positives = 26/29 89%, Gaps = 1/29 3%
Query  24   PGPNITATYGDKWLDAKATFYGSDPRGAAP 53
            PGPNITATYGDKWLDAK+T+YG  P GA P
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGAGP 34

Sequence Alignment: 51. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 47.6 bits 171,  Expect = 2e-07
 Identities = 29/83 34%, Positives = 44/83 53%, Gaps = 1/83 1%
Query  164  TKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKP 223
            TK+ + VEKGS    L L +KY      +  V+++  GS+ + PM    G +W +   KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMT-KKGNLWEVKSAKP 59
Query  224  LKGPFTIRLTSESGGHVEQEDVIP 247
            L GP   R+ S+ G     ++VIP
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIP 83

Sequence Alignment: 52. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 47.7 bits 172,  Expect = 2e-07
 Identities = 33/93 35%, Positives = 57/93 61%, Gaps = 6/93 6%
Query  164  TKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKG-SDVFLPMKLSWGAIWRMDPPK 222
            T +T+ + K S+   L L+   A+ D  +  V +K KG +D    +K S    +  +  +
Sbjct  25   TLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  223  PLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQ 261
            P+KGP+++R+  +  G+   +DVIP D+KP +VYK+K Q
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQ 118

Sequence Alignment: 53. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 45.0 bits 157,  Expect = 4e-07
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  24   PGPNITATYGDKWLDAKATFYGSDPRGA 51
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32

Sequence Alignment: 54. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 46.8 bits 168,  Expect = 4e-07
 Identities = 31/93 33%, Positives = 53/93 56%, Gaps = 6/93 6%
Query  164  TKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLP-MKLSWGAIWRMDPPK 222
            T +T  V K S+   L+L+   A  +     V +KPKG+  F   +K S    + +D  +
Sbjct  27   TTLTIEVGKDSTSTKLSLITNVAISE-----VSVKPKGATDFTDDLKESEPKTFTLDSKE 81
Query  223  PLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQ 261
            P++GP   R+ ++ GG+   ++ IP D+K  +VYK+  Q
Sbjct  82   PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQ 120

Sequence Alignment: 55. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 46.3 bits 166,  Expect = 6e-07
 Identities = 28/92 30%, Positives = 50/92 54%, Gaps = 1/92 1%
Query  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
            K+ + V+KGS    LAL + Y   + ++  V+++  GS+ + P+    G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLT-KKGDVWEVSCSKPL 82
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257
             GPF  R+ S++G     ++V   D+K    Y+
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYE 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.