The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEEN
PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAE
LVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVS
APGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIR
ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA
NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPA
GHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERI
FKNQDQAFFFPGPNKQQEEGGRGGRAFE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL86739 Cor a 11 448 3005 691.3 2.6e-200
A0A2I4E5L6 Jug r 6.0101 502 1683 389.9 1.5e-109
EF116865 Pis v 3.0101 519 1678 388.8 3.5e-109
AAK15089 Ses i 3 585 1663 385.3 4.3e-108
AAM73730 Ana o 1.0101 538 1622 376.0 2.6e-105
AAM73729 Ana o 1.0102 536 1621 375.8 3e-105
AAF18269 Jug r 2 593 1091 254.9 7.8e-69
AAM54366 Jug n 2 481 1084 253.4 1.9e-68
B3STU4 Car i 2.0101 792 1086 253.8 2.4e-68
Q9SPL4 Mac i 1.0201 666 1069 249.9 2.9e-67
Q9SPL3 Mac i 1.0101 625 1063 248.5 6.9e-67
P09801 Gos h 1 588 891 209.3 4.1e-55
P09799 Gos h 2 605 880 206.8 2.4e-54
V9VGU0 Pin k 2.0101 463 710 168.1 8.2e-43
AAB23463 Gly m conglycinin 439 627 149.2 3.8e-37
ACB05815 Lup an 1.0101 611 527 126.4 4.1e-30
P43237 Ara h 1 614 512 122.9 4.4e-29
P43238 Ara h 1 626 512 122.9 4.5e-29
Q9FZP9 Gly m 5.0201 559 497 119.5 4.2e-28
O22120 Gly m 5.0101 543 487 117.3 2e-27
CAF25232 Pis s 1.0101 415 482 116.2 3.2e-27
CAA35691 Gly m conglycinin 605 476 114.7 1.3e-26
CAD87731 Len c 1.0102 415 470 113.5 2.1e-26
CAD87730 Len c 1.0101 418 470 113.5 2.1e-26
CAF25233 Pis s 1.0102 415 468 113.0 2.9e-26
Q198W3 Vig r 2.0101 453 425 103.2 2.9e-23
B1NPN8 Vig r 2.0201 454 404 98.4 8e-22
AAB01374 Gly m conglycinin 639 380 92.9 5.2e-20
AAA33947 Gly m conglycinin 218 353 87.1 9.9e-19
A0A0S3B0K0 Coc n 1.0101 490 261 65.8 5.6e-12
BAB21619 Gly m Bd28K 473 200 51.9 8.3e-08
P11828 Gly m 6.0301 481 168 44.6 1.3e-05
AAA33966 Gly m glycinin G1 495 165 43.9 2.2e-05
P04776 Gly m 6.0101 495 165 43.9 2.2e-05
CAA68460 Gly m glycinin G2 485 164 43.7 2.5e-05
P04405 Gly m 6.0201 485 164 43.7 2.5e-05
AAL73404 Cor a 9 515 151 40.7 0.00021
BAA21758 Fag e 1 565 130 35.9 0.0065
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 691.3 bits 3005,  Expect = 3e-200
 Identities = 448/448 100%, Positives = 448/448 100%, Gaps = 0/448 0%
Query  1    MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEEN 60
            MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEEN
Sbjct  1    MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEEN 60
Query  61   PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAE 120
            PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAE
Sbjct  61   PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAE 120
Query  121  LVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVS 180
            LVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVS
Sbjct  121  LVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVS 180
Query  181  APGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIR 240
            APGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIR
Sbjct  181  APGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIR 240
Query  241  ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA 300
            ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA
Sbjct  241  ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA 300
Query  301  NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPA 360
            NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPA
Sbjct  301  NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPA 360
Query  361  GHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERI 420
            GHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERI
Sbjct  361  GHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERI 420
Query  421  FKNQDQAFFFPGPNKQQEEGGRGGRAFE 448
            FKNQDQAFFFPGPNKQQEEGGRGGRAFE
Sbjct  421  FKNQDQAFFFPGPNKQQEEGGRGGRAFE 448

Sequence Alignment: 2. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 389.9 bits 1683,  Expect = 2e-109
 Identities = 348/444 78%, Positives = 409/444 92%, Gaps = 36/444 8%
Query  2    LPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEE-----KARERQQ----EEGNSSEES 52
            L  +DPELK+CKH+CR +RQFDEQ++   ++ C+E     KARER +    EEG+S EE 
Sbjct  26   LAMQDPELKQCKHQCRHQRQFDEQEKEHCQRSCDEYHIEKKARERAERRRSEEGSSREEG 85
Query  53   Y------GKEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEA 106
            Y      G+ +EENPYVF+DE FE+RV+T+EGR+QVLE FTKRS+LL GIENFR+AILEA
Sbjct  86   YEEEELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEA 145
Query  107  NPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDE 166
            NP+TFISPAHFDAELV+FVAKGRATIT VREEKRE+FNVE+GDI+RIPAGTPVY+INRDE
Sbjct  146  NPQTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDE 205
Query  167  NEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQ 226
            NEKL+IVKIL+PVS PGHFEAF+G+GGEDPESFYRAFSWEVLEAALK RR+QLEK+FG+Q
Sbjct  206  NEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEKLFGKQ 265
Query  227  SKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDD 286
            ++G I+KAS+E+IR++S+HEE  PRIWPFGG+S+ P NL+HK PSQSNQFGRL+E  P +
Sbjct  266  TQGVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFGRLFETDPKE 325
Query  287  HKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSS------- 339
             KQLQDLDLMVSFANITKGSMAGPYYNSRATKISVV+EGEG+FEMACPHLSSS       
Sbjct  326  CKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQRE 385
Query  340  -SGS----------YQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSR 388
             SGS          YQ+I  RLR G+VFVAPAGHPVAVIAS+N NLQVLCF+VNA+GN R
Sbjct  386  GSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGNIR 445
Query  389  FPLAGKGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGRAFE 448
            FPLAGK NIVNEFE++AKELAFN+P+REVE+IF+NQDQ FFFPGP++Q EEGG   RAFE
Sbjct  446  FPLAGKNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEEGG---RAFE 502

Sequence Alignment: 3. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 388.8 bits 1678,  Expect = 4e-109
 Identities = 255/434 58%, Positives = 337/434 77%, Gaps = 18/434 4%
Query  6    DPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSS---EESYG----KEQE 58
            +  L +C  +C  ERQ   QQ++  +  C+EK ++ ++E   S    EE  G    +E++
Sbjct  68   EKRLSQCMKQC--ERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDEEQEEED 125
Query  59   ENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFD 118
            ENPYVF+DEHF +RVKTE+G+V VL  FTKRS+LL G+E +RLA L ANP+ F+ P H D
Sbjct  126  ENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMD 185
Query  119  AELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQP 178
            A+ ++FV+ GR TIT +RE KRES NV++GDIIRI AGTP Y++N DENEKL+IVK+LQP
Sbjct  186  ADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQP 245
Query  179  VSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREK 238
            V+ PGH+E F+G GGE+PESFYRAFS EVLEAALK  R++LEK+F +Q +G+IVKAS+E+
Sbjct  246  VNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIVKASKEQ 305
Query  239  IRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVS 298
            IRA+S+  EGP  IWPF G+S+G  NL+ K PSQSN +G+L+E+   D+  LQ+LD+MVS
Sbjct  306  IRAMSRRGEGPS-IWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQELDIMVS 364
Query  299  FANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSS--SG------SYQKISARL 350
            + NITKG M+GP+YNSRATKI++VV GEG +E+ACPHLSSS  SG      SY+K+S+ +
Sbjct  365  YVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKKLSSSI 424
Query  351  RRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAF 410
            R   VFV PAGHP   +AS N NL++LCFEVNA GN R+ LAGK NI+   E++AKELAF
Sbjct  425  RTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKEAKELAF 484
Query  411  NLPSREVERIFKNQDQAFFFPGPNKQQEEGGR 442
                 EV+++F  QD+ FFF GP  +Q + GR
Sbjct  485  KTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGR 516
 Score = 44.8 bits 169,  Expect = 1e-05
 Identities = 24/52 46%, Positives = 36/52 69%, Gaps = 3/52 5%
Query  4    KEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARE---RQQEEGNSSEESYGK 55
            K DPELK+CKH+C+ +RQ+DE+Q+    + CE+  +E   R+QEE    E   G+
Sbjct  1    KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEEEEEEWGSGR 55

Sequence Alignment: 4. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 385.3 bits 1663,  Expect = 4e-108
 Identities = 247/433 57%, Positives = 347/433 80%, Gaps = 25/433 5%
Query  6    DPE--LKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEEN--- 60
            DPE   ++C+ +CR + +     R   ++  EEK RE+Q  EG   E   G+E+EE    
Sbjct  129  DPEKQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEE 188
Query  61   ------PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
                  PYVF+D+HF +  +T+ GR++VL+ FT RS LL GIEN+R+AILEA P+TFI P
Sbjct  189  QGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVP 248
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
             H+DAE V+FVAKGR TI++VR+++RES+N+++GDI++I AGT  Y+INRD NE+L + K
Sbjct  249  NHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAK 308
Query  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKA 234
            +LQPVS PG FE F+GAGGE+PESF+++FS E+LEAA+  RR++L+++FG+Q +G IVKA
Sbjct  309  LLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQRQGVIVKA 368
Query  235  SREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLD 294
            S E++RA+S+HEEG   IWPFGGES G IN+ ++ P++SNQ+G+L+E     ++QL+DLD
Sbjct  369  SEEQVRAMSRHEEGG--IWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLD 426
Query  295  LMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ---------- 344
            L VS+ANIT+G+M  P+YNS+ATKI++VV+GEG+FEMACPH+S S GSYQ          
Sbjct  427  LTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ 486
Query  345  KISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERD 404
            ++++RL RG V + PAGHP   +AS N NLQVLCFEVNA+ N +FPLAG+ N++N++ER+
Sbjct  487  RVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLERE 546
Query  405  AKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGR 442
            AKELAF +P+REVE + ++Q + FFF GP +QQ+  GR
Sbjct  547  AKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQ--GR 582
 Score = 39.1 bits 144,  Expect = 0.0007
 Identities = 17/41 41%, Positives = 30/41 73%, Gaps = 0/41 0%
Query  5    EDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEE 45
            +DPELK+CKH+C+ ++Q  ++Q+    Q C+E  R+++Q E
Sbjct  26   KDPELKQCKHQCKAQQQISKEQKEACIQACKEYIRQKHQGE 66

Sequence Alignment: 5. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 376.0 bits 1622,  Expect = 3e-105
 Identities = 238/436 54%, Positives = 332/436 76%, Gaps = 13/436 2%
Query  3    PKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEK-ARERQQ-----EEGNSSEESYGKE 56
            P E   L +C  +C  ERQ   QQ++  +  C+E+  +ER Q     E+    +E   +E
Sbjct  91   PAEK-HLSQCMRQC--ERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEE 147
Query  57   QEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAH 116
            ++ENPYVF+DE F ++VKTE+G+V +L  FT++S+LL  +E +RLA+L ANP+ F+ P+H
Sbjct  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
Query  117  FDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKIL 176
             DA+ ++FV+ GR TIT + E KRES NV +GDI+ I +GTP Y+ N DENEKL++V+ L
Sbjct  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
Query  177  QPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASR 236
            +PV+ PGHFE F+G GGE+PESFYRAFSWE+LEAALK  ++ LEK+F +Q +G+I+KAS+
Sbjct  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASK 327
Query  237  EKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLM 296
            E+IRA+S+  EGP +IWPF  ES+G   L+ K PSQSN++G+L+EA   D+  L+ LD++
Sbjct  328  EQIRAMSRRGEGP-KIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMV 386
Query  297  VSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS---YQKISARLRRG 353
            VS+ANITKG M+ P+YNSRATKI++VV GEG  E+ACPHLSSS  S   Y+K+ AR+R+ 
Sbjct  387  VSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKKLRARIRKD 446
Query  354  VVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLP 413
             VF+ PAGHP A +AS N NL+++CFEVNA GN R+ LAGK NI+   E++AKELAF + 
Sbjct  447  TVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAFKME 506
Query  414  SREVERIFKNQDQAFFFPGPNKQQEEGGR 442
              EV+++F  QD+ FFF GP  ++E+ GR
Sbjct  507  GEEVDKVFGKQDEEFFFQGPEWRKEKEGR 535
 Score = 46.6 bits 177,  Expect = 4e-06
 Identities = 29/57 50%, Positives = 41/57 71%, Gaps = 8/57 14%
Query  2    LPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEE-----KARERQQEEGNSSEESYGKE 56
            L K DPELK+CKH+C+ +RQ+DEQQ+    + CE+     K RER++EE    EE +G  
Sbjct  25   LAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEE---EEEEWGTG 81
Query  57   QEENP 61
              + P
Sbjct  82   GVDEP 86

Sequence Alignment: 6. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 375.8 bits 1621,  Expect = 3e-105
 Identities = 237/436 54%, Positives = 332/436 76%, Gaps = 13/436 2%
Query  3    PKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEK-ARERQQ-----EEGNSSEESYGKE 56
            P E   L +C  +C  ERQ   QQ++  +  C+E+  +ER Q     E+    +E   +E
Sbjct  89   PAEK-HLSQCMRQC--ERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEE 145
Query  57   QEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAH 116
            ++ENPYVF+DE F ++VKTE+G+V +L  FT++S+LL  +E +RLA+L ANP+ F+ P+H
Sbjct  146  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 205
Query  117  FDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKIL 176
             DA+ ++FV+ GR TIT + E KRES NV +GDI+ I +GTP Y+ N DENEKL++V+ L
Sbjct  206  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 265
Query  177  QPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASR 236
            +PV+ PGHFE F+G GGE+PESFYRAFSWE+LEAALK  ++ LEK+F +Q +G+I+KAS+
Sbjct  266  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASK 325
Query  237  EKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLM 296
            E++RA+S+  EGP +IWPF  ES+G   L+ K PSQSN++G+L+EA   D+  L+ LD++
Sbjct  326  EQVRAMSRRGEGP-KIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMV 384
Query  297  VSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS---YQKISARLRRG 353
            VS+ANITKG M+ P+YNSRATKI++VV GEG  E+ACPHLSSS  S   Y+K+ AR+R+ 
Sbjct  385  VSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKKLRARIRKD 444
Query  354  VVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLP 413
             VF+ PAGHP A +AS N NL+++CFEVNA GN R+ LAGK NI+   E++AKELAF + 
Sbjct  445  TVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAFKME 504
Query  414  SREVERIFKNQDQAFFFPGPNKQQEEGGR 442
              EV+++F  QD+ FFF GP  ++E+ GR
Sbjct  505  GEEVDKVFGKQDEEFFFQGPEWRKEKEGR 533
 Score = 46.6 bits 177,  Expect = 4e-06
 Identities = 29/57 50%, Positives = 41/57 71%, Gaps = 8/57 14%
Query  2    LPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEE-----KARERQQEEGNSSEESYGKE 56
            L K DPELK+CKH+C+ +RQ+DEQQ+    + CE+     K RER++EE    EE +G  
Sbjct  23   LAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEE---EEEEWGTG 79
Query  57   QEENP 61
              + P
Sbjct  80   GVDEP 84

Sequence Alignment: 7. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 254.9 bits 1091,  Expect = 8e-69
 Identities = 221/437 50%, Positives = 330/437 75%, Gaps = 30/437 6%
Query  4    KEDPELK--KCKHKCRDERQFDEQQRRDGKQICEEKARERQ-QEEG---NSSEESYGKEQ 57
            ++DP+ +  +C+ +C+ + Q  E+QR+  +Q CE + +E+Q +E G   +   ES G+E+
Sbjct  116  RQDPQQQYHRCQRRCQIQEQSPERQRQ-CQQRCERQYKEQQGRERGPEASPRRESRGREE 174
Query  58   EE---NPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
            E+   NPY F+ +   SR ++EEG V+ LE FT+R+ LL GIEN+R+ IL+ANP+T + P
Sbjct  175  EQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLP 234
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
             H DAE V  V +GRAT+T+V +E RESFN+E GD+IR+PAG  VY+IN+D NE+L +VK
Sbjct  235  HHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVK 294
Query  175  ILQPVSAPGHFEAFYGAGGEDPE-SFYRAFSWEVLEAALKVRREQLEKVFG--EQSKGSI 231
            +LQPV+ PG+F  +Y AG + P+ S+ R FS ++L AAL   R++LE+ F   EQ +G I
Sbjct  295  LLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVI 354
Query  232  VKASREKIRALSQHEEGPPRIWPFGGESSG-PINLLHKHPSQSNQFGRLYEAHPDDHKQL 290
            ++AS+EK+RALSQH     +  P+G  SSG PI+L  + PS SNQFG+++EA P++H+QL
Sbjct  355  IRASQEKLRALSQHAMSAGQ-RPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQL 413
Query  291  QDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSS------------ 338
            Q++D++V++A I +G+M  P+YNS+AT +  VVEG G +EMACPH+SS            
Sbjct  414  QEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQE 473
Query  339  ---SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKG 395
               S+G +QK++ARL RG +FV PAGHP+A+ ASQN NL++L F++N   N R  LAG+ 
Sbjct  474  EEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQN 533
Query  396  NIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGR 442
            NI+N++ER+AKEL+FN+P  E+E IF++Q +++F P   + +   GR
Sbjct  534  NIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGR 580

Sequence Alignment: 8. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 253.4 bits 1084,  Expect = 2e-68
 Identities = 218/437 49%, Positives = 328/437 75%, Gaps = 30/437 6%
Query  4    KEDPELK--KCKHKCRDERQFDEQQRRDGKQICEEKARERQ-QEEG---NSSEESYGKEQ 57
            ++DP+ +  +C+ +C+ + Q  E+QR+  +Q CE + +E+Q +E G   +   ES G+E+
Sbjct  4    RQDPQQQYHRCQRRCQIQEQSPERQRQ-CQQRCERQYKEQQGRERGPEASPRRESKGREE 62
Query  58   EE---NPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
            E+   NPY F+ +   SR ++EEG V+ LE F +R+ LL GIEN+R+ IL+ANP+TF+ P
Sbjct  63   EQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLP 122
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
             H DAE V+ V +GRAT+T+V +E RESFN+E GD+IR+PAG   Y+IN+D NE+L +VK
Sbjct  123  HHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVK 182
Query  175  ILQPVSAPGHFEAFYGAGGEDPE-SFYRAFSWEVLEAALKVRREQLEKVFG--EQSKGSI 231
            +LQPV+ PG+   +Y AG + P+ S+ R FS ++L AAL   R++LE+ F   EQ +G I
Sbjct  183  LLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVI 242
Query  232  VKASREKIRALSQHEEGPPRIWPFGGESSG-PINLLHKHPSQSNQFGRLYEAHPDDHKQL 290
            ++AS+EK+RALSQH     +  P+G  SSG PI+L  + PS SNQFG+++EA P++H+QL
Sbjct  243  IRASQEKLRALSQHAMSAGQ-RPWGRRSSGGPISLKSERPSYSNQFGQFFEACPEEHRQL 301
Query  291  QDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSS------------ 338
            Q++D++V++A I +G+M  P+YNS+AT +  VVEG G +EMACPH+SS            
Sbjct  302  QEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQE 361
Query  339  ---SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKG 395
               S+G +QK++ARL RG +FV PAGHP+A+ ASQN NL++L F +N   N R  LAG+ 
Sbjct  362  EEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAGQN 421
Query  396  NIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGR 442
            +I+N++ER+AKEL+FN+P  E+E IF++Q +++F P   + +   GR
Sbjct  422  SIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGR 468

Sequence Alignment: 9. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 253.8 bits 1086,  Expect = 2e-68
 Identities = 219/437 50%, Positives = 326/437 74%, Gaps = 32/437 7%
Query  4    KEDPELK--KCKHKCRDERQFDEQQRRDGKQICEEKARERQQEE-----GNSSEESYGKE 56
            ++DP+ +  +C+ +C+ + Q  E+QR+  +Q CE + +E+Q  E      +   ES G+E
Sbjct  312  RQDPQQQYHRCQRRCQTQEQSPERQRQ-CQQRCERQYKEQQGREWGPDQASPRRESRGRE 370
Query  57   QEE---NPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFIS 113
            +E+   NPY F+ + + SR ++ EG V+ LE FT+R+ LL GIEN+R+ ILEANP+TF+ 
Sbjct  371  EEQQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVL 430
Query  114  PAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIV 173
            P H DAE V+ V +GRAT+T V +E+RESFN+E+GD+IR+PAG   Y+IN+D NE+L +V
Sbjct  431  PYHKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMV 490
Query  174  KILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFG--EQSKGSI 231
            K+LQPV+ PG+F  +Y AG +  ES+ R FS ++L AAL   R++LE+ F   EQ +G I
Sbjct  491  KLLQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVI 550
Query  232  VKASREKIRALSQHEEGPPRIWPFGGESSG-PINLLHKHPSQSNQFGRLYEAHPDDHKQL 290
            ++AS+EK+RALSQH     +  P+G  SSG PI+L  +  S SNQFG+++EA P++H+QL
Sbjct  551  IRASQEKLRALSQHAMSAGQ-RPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQL 609
Query  291  QDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH-LSS----------- 338
            Q++D++V++A I +G+M  P+YNS+AT +  VVEG G FEMACPH +SS           
Sbjct  610  QEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQ 669
Query  339  -----SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG 393
                 S+G +QK++ARL RG +FV PAGHP+A+ ASQN NL+++ F +N   N R  LAG
Sbjct  670  EEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAG 729
Query  394  KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGR 442
            + NI+N++ER+AKEL+FN+P  E+E IF+ Q +++F P   + +   GR
Sbjct  730  QNNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPMERQSRRGQGR 778

Sequence Alignment: 10. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 249.9 bits 1069,  Expect = 3e-67
 Identities = 204/438 46%, Positives = 302/438 68%, Gaps = 33/438 7%
Query  4    KEDP---ELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQ-------EEGNSSEESY 53
            K DP   E + C+ +C  E+Q   QQ +  ++ C E+ R+  +       + G S     
Sbjct  186  KRDPQQREYEDCRRRC--EQQEPRQQYQCQRR-CREQQRQHGRGGDLINPQRGGSGRYEE 242
Query  54   GKE-QEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFI 112
            G+E Q +NPY F +  + +R +TEEG + VLENF  RS+LL  ++N+RL +LEANP+ F+
Sbjct  243  GEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFV 302
Query  113  SPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFI 172
             P H+DA+ +L+V  GR  + M+  + RES+N+E GD+IRIPAGT  Y+INRD NE+L I
Sbjct  303  LPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHI 362
Query  173  VKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIV 232
             K LQ +S PG+++ F+ AGG++PE +   FS E+LEAAL  + E+L  V+G+Q +G I+
Sbjct  363  AKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGVII 422
Query  233  KASREKIRALSQHEEGPPRIWPF--GGESS-GPINLLHKHPSQSNQFGRLYEAHPDDHKQ 289
             AS+E+IR L++ ++   R W    GGESS GP NL++K P  SN++G+ YE  P+D++Q
Sbjct  423  SASQEQIRELTR-DDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQ 481
Query  290  LQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS------- 342
            LQD+D+ V  ANIT+GSM GP++N+R+TK+ VV  GE   EMACPHLS   G        
Sbjct  482  LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRH 541
Query  343  -------YQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKG 395
                   Y+++ ARL +    V P GHPV  ++S N NL ++ F +NA+ N    LAG+ 
Sbjct  542  EEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRE 601
Query  396  -NIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGR 445
             N++ + E  A ELAF  P +EVE +F +QD++ FFPGP ++Q++  R  +
Sbjct  602  RNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTK 652

Sequence Alignment: 11. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 248.5 bits 1063,  Expect = 7e-67
 Identities = 204/436 46%, Positives = 302/436 69%, Gaps = 37/436 8%
Query  4    KEDP---ELKKCKHKC-RDERQFDEQ-QRRDGKQICEEKARERQQ-------EEGNSSEE 51
            K DP   E + C+  C + E ++  Q QRR     C+E+ R+  +       + G S   
Sbjct  145  KRDPQQREYEDCRRHCEQQEPRLQYQCQRR-----CQEQQRQHGRGGDLMNPQRGGSGRY 199
Query  52   SYGKE-QEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHT 110
              G+E Q +NPY F +  + +R +TEEG + VLENF  RS+LL  ++N+RL +LEANP+ 
Sbjct  200  EEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNA 259
Query  111  FISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKL 170
            F+ P H+DA+ +L+V  GR  + M+  + RES+N+E GD+IRIPAGT  Y+INRD NE+L
Sbjct  260  FVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERL 319
Query  171  FIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGS 230
             I K LQ +S PG+++ F+ AGG++PE +   FS E+LEAAL  + E+L  V+G+Q +G 
Sbjct  320  HIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLGQQREGV 379
Query  231  IVKASREKIRALSQHEEGPPRIWPF--GGESS-GPINLLHKHPSQSNQFGRLYEAHPDDH 287
            I++AS+E+IR L++ ++   R W    GGESS GP NL++K P  SN++G+ YE  P+D+
Sbjct  380  IIRASQEQIRELTR-DDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDY 438
Query  288  KQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS----- 342
            +QLQD+D+ V  ANIT+GSM GP++N+R+TK+ VV  GE   EMACPHLS   G      
Sbjct  439  RQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGK 498
Query  343  ---------YQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG 393
                     Y+++ ARL +    V  AGHPV  ++S N NL ++ F +NA+ N    LAG
Sbjct  499  RHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQNNHENFLAG 558
Query  394  KG-NIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGR 445
            +  N++ + E  A ELAF    +EVE +F +QD++ FFPGP ++Q++  R  +
Sbjct  559  RERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPRQHQQQSPRSTK 611

Sequence Alignment: 12. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 209.3 bits 891,  Expect = 4e-55
 Identities = 192/422 45%, Positives = 283/422 67%, Gaps = 49/422 11%
Query  8    ELKKCKHKCRDERQFDEQQRRDGKQICEEKARE----RQQEEGNSSEESYGKEQEE--NP 61
            ++++C++ C  + Q  E++++  ++ C E+ +E    R++EE    EE+   EQE+  NP
Sbjct  123  QFQECQQHCHQQEQRPERKQQCVRE-CRERYQENPWRREREEEAEEEETEEGEQEQSHNP 181
Query  62   YVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAEL 121
            + F+   F+SR + E G  +VL+ F  R  +L GI  FRL+ILEANP+TF+ P H DAE 
Sbjct  182  FHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAEK 241
Query  122  VLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSA 181
            + +V  GR T+T +  E +ES+NV  G ++R+PAG+ VY+ N+D  EKL I  + +PV+ 
Sbjct  242  IYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPVNN 301
Query  182  PGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFG-------EQSKGSIVKA 234
            P +FE F+ AG + P+S+ RAFS E+LE A+  R EQL+++FG       +Q +G   KA
Sbjct  302  PRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMFRKA 361
Query  235  SREKIRALSQHEEGPPRIWPFGGESSGP---INLLHKHPSQSNQFGRLYEAHPDDHKQLQ 291
            S+E+IRALSQ E   PR      E SG     NLL++ P  SNQ GR+YEA P + +QL 
Sbjct  362  SQEQIRALSQ-EATSPR------EKSGERFAFNLLYRTPRYSNQNGRFYEACPREFRQLS 414
Query  292  DLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHL--SSS---------- 339
            D+++ VS   + +GS+  P+YNS+AT + +V EG G+ EM  PHL   SS          
Sbjct  415  DINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQE 474
Query  340  --------SGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCF-----EVNAHGN 386
                    SG Y+KI ++L RG +FV PA  PV  +ASQN NL++  F      +N   N
Sbjct  475  QEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHN 534
Query  387  SRFPLAGKGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQ 437
             R  +AGK N V +++  AKELAF + SR V+ IF N  Q  +F    +Q+
Sbjct  535  QRIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQRQR 585

Sequence Alignment: 13. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 206.8 bits 880,  Expect = 2e-54
 Identities = 198/426 46%, Positives = 284/426 66%, Gaps = 46/426 10%
Query  4    KEDPELKK-CKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPY 62
            ++ PE K+ C  +CR++ Q D  +   G++  E K RE ++EE +  E+    +Q  NPY
Sbjct  133  EQRPERKQQCVKECREQYQEDPWK---GER--ENKWREEEEEESDEGEQ----QQRNNPY 183
Query  63   VFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELV 122
             F+   F+ R + E G  +VL+ F  +  LL GI  FR+AILEANP+TF+ P H DAE +
Sbjct  184  YFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAEKI 243
Query  123  LFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAP 182
              V  GR T+T V  E +ES+NV  G ++RIPAG+ VY+ N+D  EKL I  + +PV+ P
Sbjct  244  YVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPVNNP 303
Query  183  GHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFG-------EQSKGSIVKAS 235
            G+F+ F+ AG E+P+S+ R FS E+LEA +  R EQL+++ G       +Q +G   KAS
Sbjct  304  GQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKAS 363
Query  236  REKIRALSQHEEGPPRIWPFGGESSG-PINLLHKHPSQSNQFGRLYEAHPDD-HKQLQDL 293
            +E+IRALSQ    P      G  S G   NLL + P  SNQ GR+YEA P + ++QL+++
Sbjct  364  QEQIRALSQGATSPR-----GKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREV 418
Query  294  DLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLS--SS------------ 339
            D  V    I KGS+  P+YNS+AT + +V EG G  EM CPHLS  SS            
Sbjct  419  DSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEE 478
Query  340  ------SGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV-NAHGNSRFPLA 392
                  SG Y+++ A+L  G +FV PAGHPV  +ASQN +L +L F + N + N R  +A
Sbjct  479  QEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVA 538
Query  393  GKGNIVNEFERDAKELAFNLPSREVERIFKNQDQ-AFFFPGPNKQQEEGGRG 443
            GK N V +++R AKELAF + SR V+ +F N  Q ++F  G +++  +  RG
Sbjct  539  GKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRG 590

Sequence Alignment: 14. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 168.1 bits 710,  Expect = 8e-43
 Identities = 159/418 38%, Positives = 246/418 58%, Gaps = 21/418 5%
Query  18   DERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYVFQDEHFESRVKTEE 77
            D+  F EQ+ R    +  E+   R +  G   EE     +EENPYVF+ + F  R  +E 
Sbjct  29   DQGVFPEQHGRGHHGVFPEE-HGRGHHRGGREEE-----REENPYVFHSDRFRIRASSEA 82
Query  78   GRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRATITMVRE 137
            G ++ L NF + S LL GI  +R+  +E  P+T + P + DA+ +L+V  GR  I  V++
Sbjct  83   GEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQ 142
Query  138  EKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAP-GHFEAFYGAGGEDP 196
             +     +E GD+  +P+G   Y++N D++  L I  +L+  S   G +E FY AGG +P
Sbjct  143  NELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNP 202
Query  197  ESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIRALSQHEEGPPRIWPFG 256
            E+ Y AFS +VLEAA+    ++LE +FG + +G I  A+ E+IR +     G        
Sbjct  203  ETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREM-MRRGGFSAESTSA 261
Query  257  GESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRA 316
             E   P NL ++ P   N  GR+  A P D+  L  +D+ V F  +  G+M  P +N++A
Sbjct  262  SEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKA 321
Query  317  TKISVVVEGEGFFEMACPHLSSSSG------------SYQKISARLRRGVVFVAPAGHPV 364
            T I++V+EGEG  EMACPHL    G            +Y+++ ARLR G V+V PAGHP+
Sbjct  322  TSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPI 381
Query  365  AVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLP-SREVERIFKN 423
              IAS N  L++L F++N  GN R  LAGK N++  +E++ + L+FN+P   E+E +++ 
Sbjct  382  TEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQA 441
Query  424  QDQAFFFPGPNKQQEEGGR 442
            Q     + GP +Q+ +  R
Sbjct  442  QKDQVILRGPQRQRRDEPR 460

Sequence Alignment: 15. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 149.2 bits 627,  Expect = 4e-37
 Identities = 140/385 36%, Positives = 237/385 61%, Gaps = 19/385 4%
Query  55   KEQEENPYVFQDEH-FESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFIS 113
            +E E NP+ F+  + F++  + +  R+++L+ F KRS  L  + ++R+  +++ P+T + 
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  114  PAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIV 173
            P H DA+++LFV  GRA +T+V  + R+S+N+  GD  RIPAGT  Y++N  +++ L I+
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  174  KILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-FGE-----QS 227
            K+  PV+ PG ++ F+ +  +  +S+ + FS  +LE ++    E++ +V FGE     Q 
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
Query  228  KGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDH 287
            +G IV+ S+E+IR LS+  +   R      E   P NL  ++P  SN FG+++E  P+ +
Sbjct  207  EGVIVELSKEQIRQLSRRAKSSSRK-TISSEDE-PFNLRSRNPIYSNNFGKFFEITPEKN 264
Query  288  KQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSY---- 343
             QL+DLD+ +S  +I +G++  P++NS+A  I V+ EG+   E+                
Sbjct  265  PQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEP 324
Query  344  ---QKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVN 399
               Q+  A L    VFV PA +P  V A+  +NL  L F +NA  N R  LAG K N+V 
Sbjct  325  LEVQRYRAELSEDDVFVIPAAYPFVVNAT--SNLNFLAFGINAENNQRNFLAGEKDNVVR 382
Query  400  EFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443
            + ER  +ELAF   +++VER++K Q +++F     +Q+EEG +G
Sbjct  383  QIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKG 426

Sequence Alignment: 16. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 126.4 bits 527,  Expect = 4e-30
 Identities = 164/433 37%, Positives = 278/433 64%, Gaps = 51/433 11%
Query  4    KEDPELKKCKHKCRDERQFDEQ--QRRDGKQICEEKARERQQEEGNSSEESYG-KEQEEN 60
            ++ P+ ++ + + R++ Q      QR  G +  + + R  ++EE    ++S     ++ N
Sbjct  125  RQRPQSRREEREEREQEQGSSSGSQRGGGDERRQHRERRVHREEREQEQDSRSDSRRQRN 184
Query  61   PYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAE 120
            PY F    F++  +   G+++VLE F +R+  L  ++N+R+  +++ P+T+I P H DA+
Sbjct  185  PYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDAD 244
Query  121  LVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVS 180
            ++L V  GRATIT+V  +KR+ +N+E+GD +R+PAGT  Y++N D+N+ L + K+  P++
Sbjct  245  FILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLAIPIN 304
Query  181  APGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVF-GE-------------- 225
             PG +  FY +  +D +S++  FS   LEA +  R E++E+V+ G+              
Sbjct  305  NPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRRGQE 364
Query  226  ---QSKGSIVKASREKIRALSQHE-----EGPPRIWPFGGESSGPINLLHKHPSQSNQFG 277
               Q +G IV+ S+++I+ L +H      EG P         SGP NL    P  SN+FG
Sbjct  365  QSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPS-------ESGPFNLRSNKPIYSNKFG 417
Query  278  RLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLS 337
             +YE  PD + Q+QDL++ ++F  I +G++  P+YNS+A  I VV EGEG +E+      
Sbjct  418  NFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQ 477
Query  338  SSSGSYQ------------KISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHG 385
                  Q            + S +L +G VF+ PAGHP+++ AS  +NL++L F +NA+ 
Sbjct  478  QRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINAS--SNLRLLGFGINANE 535
Query  386  NSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFF---PGPNKQQEEGG 441
            N R  LAG + N++ +++R+ KEL F     +VER+ KNQ Q++F    P   +Q+E+ G
Sbjct  536  NQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEG 595
Query  442  RGGR 445
            R GR
Sbjct  596  RRGR 599

Sequence Alignment: 17. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 122.9 bits 512,  Expect = 4e-29
 Identities = 169/437 38%, Positives = 267/437 61%, Gaps = 58/437 13%
Query  7    PELKKCKHKCRDERQFDEQQRRDGKQICEE---KARERQQEEGNSSEESYGKEQEENPYV 63
            P   + + +  D RQ  E  RR   Q   +   + RE +QE G    E   +    NP+ 
Sbjct  111  PAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSEVREETSRNNPFY 170
Query  64   FQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVL 123
            F    F +R   + GR++VL+ F +RS+ +  ++N R+  +EA P+T++ P H DA+ +L
Sbjct  171  FPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPKHADADNIL 230
Query  124  FVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPG 183
             + +G+AT+T+     R+SFN++ G  +RIP+G   Y++NR +N+ L + KI  PV+ PG
Sbjct  231  VIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPG 290
Query  184  HFEAFYGAGGEDPESFYRAFSWEVLEAAL-----KVRREQLEK-VFGEQ----------- 226
            +FE F+ A   D  S+ + FS   LEAA+     ++RR  LE+   GEQ           
Sbjct  291  QFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRRSTR 350
Query  227  ---SKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAH 283
               ++G IVK S+E ++ L++H +   +      + + PINL    P  SN FGRL+E  
Sbjct  351  SSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGRLFEVK 410
Query  284  PDDHK-QLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSS-- 340
            PD    QLQDLD+M++   I +G++  P++NS+A  I VV +G G +E+           
Sbjct  411  PDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRG 470
Query  341  ----------------GSYQKI---SARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV 381
                            GS +++   +ARL+ G VF+ PA HPVA+ AS  + L++L F +
Sbjct  471  RREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS--SELHLLGFGI 528
Query  382  NAHGNSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFF---P------ 431
            NA  N R  LAG K N++++ E+ AK+LAF     +VE++ KNQ ++ F    P      
Sbjct  529  NAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPS 588
Query  432  GPNKQ-QEEGGRGGR 445
             P K+ QEE  +GG+
Sbjct  589  SPEKEDQEEENQGGK 603

Sequence Alignment: 18. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 122.9 bits 512,  Expect = 4e-29
 Identities = 162/430 37%, Positives = 257/430 59%, Gaps = 48/430 11%
Query  7    PELKKCKHKCRDERQFDEQQRRDGKQICEE---KARERQQEEGNSSEESYGKEQEENPYV 63
            P   + + +  D RQ  E  RR   Q   +   + RE +QE G        +    NP+ 
Sbjct  117  PAGPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSHVREETSRNNPFY 176
Query  64   FQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVL 123
            F    F +R   + GR++VL+ F +RSR +  ++N R+  +EA P+T++ P H DA+ +L
Sbjct  177  FPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNIL 236
Query  124  FVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPG 183
             + +G+AT+T+     R+SFN++ G  +RIP+G   Y++NR +N+ L + KI  PV+ PG
Sbjct  237  VIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPG 296
Query  184  HFEAFYGAGGEDPESFYRAFSWEVLEAAL-----KVRREQLEKVFG-------------- 224
            +FE F+ A   D  S+ + FS   LEAA+     ++RR  LE+  G              
Sbjct  297  QFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTR 356
Query  225  --EQSKGSIVKASREKIRALSQHEEGPPRIWPFG-GESSGPINLLHKHPSQSNQFGRLYE 281
              E ++G IVK S+E +  L++H +   +      G+ + PINL    P  SN FG+L+E
Sbjct  357  SSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNFGKLFE 416
Query  282  AHPDDHK-QLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSS 340
              PD    QLQDLD+M++   I +G++  P++NS+A  I VV +G G +E+         
Sbjct  417  VKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQ 476
Query  341  ---------------GSYQKI---SARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVN 382
                           GS +++   +ARL+ G VF+ PA HPVA+ AS  + L++L F +N
Sbjct  477  RGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS--SELHLLGFGIN 534
Query  383  AHGNSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPG-PNKQQE 438
            A  N R  LAG K N++++ E+ AK+LAF     +VE++ KNQ ++ F    P  Q +
Sbjct  535  AENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQ 592

Sequence Alignment: 19. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 119.5 bits 497,  Expect = 4e-28
 Identities = 146/431 33%, Positives = 264/431 61%, Gaps = 28/431 6%
Query  4    KEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYV 63
            K + + K+ KH+ ++  + +E Q  D     EE+ +E Q+ EG+ S+    + + +NP+ 
Sbjct  97   KHEWQHKQEKHQGKESEEEEEDQDED-----EEQDKESQESEGSESQREPRRHKNKNPFH 151
Query  64   FQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVL 123
            F  + F++  K + G V+VL+ F KRS+ L  + ++R+  + + P+T++ P H DA+ ++
Sbjct  152  FNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLI 211
Query  124  FVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPG 183
             +  G A +T+V  + R+S+N++ GD +R+PAGT  Y++N D +E L ++ +  PV+ PG
Sbjct  212  VILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPG 271
Query  184  HFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-FGE---QSKGS-------IV 232
             FE+F+ +  +  +S+ + FS  +LEA+   + E++ KV FG    Q +G        IV
Sbjct  272  RFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIV 331
Query  233  KASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQD 292
            + S+++IR LS+H +   R      E   P NL  + P  SN++G+L+E  P+ + QL+D
Sbjct  332  EISKKQIRELSKHAKSSSRK-TISSEDK-PFNLRSRDPIYSNKLGKLFEITPEKNPQLRD 389
Query  293  LDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ-------K 345
            LD+ +S  ++ +G++  P++NS+A  + V+ EGE   E+            +       K
Sbjct  390  LDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRK 449
Query  346  ISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVNEFERD 404
              A L    +FV PAG+PV V A+  ++L  + F +NA  N R  LAG K N++++    
Sbjct  450  YRAELSEQDIFVIPAGYPVVVNAT--SDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQ 507
Query  405  AKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443
             +ELAF   ++++E + K+Q +++F     +Q+EEG +G
Sbjct  508  VQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG 546

Sequence Alignment: 20. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 117.3 bits 487,  Expect = 2e-27
 Identities = 148/421 35%, Positives = 258/421 61%, Gaps = 30/421 7%
Query  17   RDERQFD----EQQRRDGKQICEEKARERQQEEGNSSEES-YGKEQEENPYVFQDEHFES 71
            +DERQF      +Q+ + KQ  EE   E QQ E   SE+S   + + +NP++F    FE+
Sbjct  86   QDERQFPFPRPPHQKEERKQ--EEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFET 143
Query  72   RVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRAT 131
              K + GR++VL+ F +RS  L  + ++R+  + + P+T++ P H DA+ ++ +  G A 
Sbjct  144  LFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAI 203
Query  132  ITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGA 191
            +++V  + R+S+ ++ GD +R+P+GT  Y++N D NE L ++ +  PV+ PG FE+F+ +
Sbjct  204  LSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLS 263
Query  192  GGEDPESFYRAFSWEVLEAALKVRREQLEKVF---------GEQ--SKGSIVKASREKIR 240
              E  +S+ + FS  +LEA+   + E++ KV+         GEQ   +  IV+ S+E+IR
Sbjct  264  STEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR 323
Query  241  ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA 300
            ALS+  +   R      E   P NL  + P  SN++G+++E  P+ + QL+DLD+ +S  
Sbjct  324  ALSKRAKSSSRK-TISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIV 381
Query  301  NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ-------KISARLRRG 353
            ++ +G++  P++NS+A  I V+ EG+   E+            +       K  A L   
Sbjct  382  DMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQ 441
Query  354  VVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVNEFERDAKELAFNL 412
             +FV PAG+PV V A+  +NL  +   +NA  N R  LAG + N++++     +ELAF  
Sbjct  442  DIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPG 499
Query  413  PSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443
             ++ VE+++KNQ +++F     K++EEG +G
Sbjct  500  SAQAVEKLLKNQRESYFVDAQPKKKEEGNKG 530

Sequence Alignment: 21. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 116.2 bits 482,  Expect = 3e-27
 Identities = 156/380 41%, Positives = 248/380 65%, Gaps = 38/380 10%
Query  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ PHT+  P
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
             + DA+++L V  G+AT+T+++   R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
Query  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSK------ 228
            +  PV+ PG++++F  +G ++  S+   FS  +LEAA+    E++EKV+ EQ +      
Sbjct  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  229  -------------GSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
                           IVK SRE+I  LS++ +   +      ES GP NL  ++P  SN+
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKK-SVSSES-GPFNLRSRNPIYSNK 239
Query  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH 335
            FG+++E  P+ ++QLQDLD+ V+  +I +GS+  P YNSRA  I  V EG+G FE+    
Sbjct  240  FGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR 299
Query  336  LSS--------------SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV 381
              +              +S   Q   A+L  G VFV PAGHPVA+ AS + NL  + F +
Sbjct  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGI 357
Query  382  NAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQE 438
            NA  N R  LAG+  N++++ ER  KELAF   S EV+R++KNQ Q++F      Q+E
Sbjct  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 22. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 114.7 bits 476,  Expect = 1e-26
 Identities = 146/421 34%, Positives = 257/421 61%, Gaps = 30/421 7%
Query  17   RDERQFD----EQQRRDGKQICEEKARERQQEEGNSSEES-YGKEQEENPYVFQDEHFES 71
            +DERQF      +Q+ +  +  EE   E QQ E   SE+S   + + +NP++F    FE+
Sbjct  148  QDERQFPFPRPPHQKEERNE--EEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFET 205
Query  72   RVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRAT 131
              K + GR++VL+ F +RS  L  + ++R+  + + P+T++ P H DA+ ++ +  G A 
Sbjct  206  LFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAI 265
Query  132  ITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGA 191
            +++V  + R+S+ ++ GD +R+P+GT  Y++N D NE L ++ +  PV+ PG FE+F+ +
Sbjct  266  LSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLS 325
Query  192  GGEDPESFYRAFSWEVLEAALKVRREQLEKVF---------GEQ--SKGSIVKASREKIR 240
              E  +S+ + FS  +LEA+   + E++ KV+         GEQ   +  IV+ S+E+IR
Sbjct  326  STEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR 385
Query  241  ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA 300
            ALS+  +   R      E   P NL  + P  SN++G+++E  P+ + QL+DLD+ +S  
Sbjct  386  ALSKRAKSSSRK-TISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIV 443
Query  301  NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ-------KISARLRRG 353
            ++ +G++  P++NS+A  I V+ EG+   E+            +       K  A L   
Sbjct  444  DMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQ 503
Query  354  VVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVNEFERDAKELAFNL 412
             +FV PAG+PV V A+  +NL  +   +NA  N R  LAG + N++++     +ELAF  
Sbjct  504  DIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPG 561
Query  413  PSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443
             ++ VE+++KNQ +++F     K++EEG +G
Sbjct  562  SAQAVEKLLKNQRESYFVDAQPKKKEEGNKG 592

Sequence Alignment: 23. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 113.5 bits 470,  Expect = 2e-26
 Identities = 153/371 41%, Positives = 243/371 65%, Gaps = 38/371 10%
Query  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ PHT+  P
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
             + DA+++L V  G+A +T++    R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGE------QSK 228
            +  PV+ PG++E+F  +G ++  SF   F+  +LEAA+    E++EKV+ E      Q +
Sbjct  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
Query  229  GS-------------IVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
             S             IVK SRE+I+ LS++ +   +      ES  P NL  ++P  SN+
Sbjct  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKK-SVSSESE-PFNLRSRNPIYSNK 239
Query  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH 335
            FG+++E  P+ + QLQDLD+ V+   I +GS+  P YNSRA  I  V EG+G+FE+    
Sbjct  240  FGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQR 299
Query  336  LSS--------------SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV 381
              +              +S   Q+  A+L  G VFV PAGHPVA+ AS + NL  + F +
Sbjct  300  NENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGI 357
Query  382  NAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFF 429
            NA  N R  LAG+  N++++ +R  KELAF   SREV+R++ NQ Q+ F
Sbjct  358  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406

Sequence Alignment: 24. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 113.5 bits 470,  Expect = 2e-26
 Identities = 152/371 40%, Positives = 239/371 64%, Gaps = 41/371 11%
Query  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ PHT   P
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
               DA+++L V  G+A +T++    R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVF-GEQSKGS--- 230
            +  PV+ PG++++F  +G ++  SF   FS  +LEAA+    E++EKV+  EQ + S   
Sbjct  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
Query  231  ---------------IVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
                           IVK SRE+I  LS++ +   +      ES  P NL  ++P  SN+
Sbjct  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKK-SVSSESE-PFNLRSRNPIYSNK 239
Query  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH 335
            FG+++E  P+ + QLQDLD+ V+   I +GS+  P YNSRA  I  V EG+G FE+    
Sbjct  240  FGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQR 299
Query  336  LSS-----------------SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLC 378
              +                 ++   Q+  ARL  G V+V PAGHPVA+ AS + NL  + 
Sbjct  300  NENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IG 357
Query  379  FEVNAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFF 429
            F +NA  N R  LAG+  N++++ +R  KELAF   SREV+R++ NQ Q+ F
Sbjct  358  FGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409

Sequence Alignment: 25. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 113.0 bits 468,  Expect = 3e-26
 Identities = 155/380 40%, Positives = 246/380 64%, Gaps = 38/380 10%
Query  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ P T+  P
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLP 61
Query  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
               DA+++L V  G+AT+T+++   R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  62   QCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSK------ 228
            +  PV+ PG++++F  +G ++  S+   FS  +LEAA+    E++EKV+ EQ +      
Sbjct  122  LTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  229  -------------GSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
                           IVK SRE+I  LS++ +   +      ES GP NL  ++P  SN+
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKK-SVSSES-GPFNLRSRNPIYSNK 239
Query  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH 335
            FG+++E  P+ ++QLQDLD+ V+  +I +GS+  P YNSRA  I  V EG+G FE+    
Sbjct  240  FGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR 299
Query  336  LSS--------------SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEV 381
              +              +S   Q   A+L  G VFV PAGHPVA+ AS + NL  + F +
Sbjct  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGI 357
Query  382  NAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQE 438
            NA  N R  LAG+  N++++ ER  KELAF   S EV+R++KNQ Q++F      Q+E
Sbjct  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 26. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 103.2 bits 425,  Expect = 3e-23
 Identities = 145/399 36%, Positives = 241/399 60%, Gaps = 22/399 5%
Query  42   QQEEGNSSEESYGKEQEENPYVFQ-DEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFR 100
            ++E   S EES  + Q  NP+ F  D  F +  K + G ++V+  F +RS+ +  +EN+R
Sbjct  26   HREHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR 84
Query  101  LAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVY 160
            +  +++ P+T++ P H DA+++L V  GRA +T+V  + R+S+ +E+G   +IPAGT  +
Sbjct  85   VVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF 144
Query  161  MINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLE 220
            ++N ++N+ L I+K+  PV+ P  F+ F+ +  E  +S+ R FS  +LEA++    ++++
Sbjct  145  LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEID 204
Query  221  KV-FGE----------QSKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKH 269
            +V FGE          Q +G IV+  RE+IR L +H +   R          P NL + +
Sbjct  205  RVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSR--KELSSQDEPFNLRNSN 262
Query  270  PSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFF 329
            P  SN+FGR YE  P+ + QL+DLD+ +S  ++ +G +  P+YNS+A  I V+ EGE   
Sbjct  263  PIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKI 322
Query  330  EMACP---HLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGN 386
            E+  P   +    S   Q+  A L    VFV PA +PVA+ A+  +NL  + F +NA  N
Sbjct  323  ELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAENN 380
Query  387  SRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPG-PNKQQEEGGRGG 444
             R  LAG K N+++E   +  +++F     +VE++ K Q ++ F    P +QQ E G  G
Sbjct  381  QRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKG 440
Query  445  R 445
            R
Sbjct  441  R 441

Sequence Alignment: 27. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 98.4 bits 404,  Expect = 8e-22
 Identities = 139/398 34%, Positives = 238/398 59%, Gaps = 30/398 7%
Query  41   RQQEEGNSSEESYGKEQEENPYVFQ-DEHFESRVKTEEGRVQVLENFTKRSRLLSGIENF 99
            R+  +G     S GK    NP+ F  D  F +  + + G ++VL+ F +RS+ +  +EN+
Sbjct  29   RENIDGAEVSVSRGK---NNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENY 85
Query  100  RLAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPV 159
            R+  L + P+T++ P H DA+++L V  GRA +T+V  + R+S  +E+G   +IPAGT  
Sbjct  86   RVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTF 145
Query  160  YMINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQL 219
            +++N D+NE L I+K+  PV+ P  F+ F+ +  E  +S+ + FS  +LEA++    +++
Sbjct  146  FLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEI 205
Query  220  EKV-FGE-----------QSKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLH 267
             +V FGE           Q +G IV+  RE+IR L++H +   +   +  E   P NL +
Sbjct  206  SRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKK-SLSSEDQ-PFNLRN 263
Query  268  KHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEG 327
            + P  SN++GR +E  P+ + QL+DLD+ +   ++ +GS+  P+YNS+A  I V+ EG+ 
Sbjct  264  QKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKA 323
Query  328  FFEMACPHLSSS-------SGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFE 380
              E+               S   Q+  A L    VF+ PA +PVA+ A+  +NL  + F 
Sbjct  324  NIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINAT--SNLNFFAFG 381
Query  381  VNAHGNSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQE- 438
            +NA  N R  LAG K N+++E   +  ++ F     +V+++ K Q ++ F     +QQE 
Sbjct  382  INAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQER 441
Query  439  -EGGRGGR 445
             E  +GG+
Sbjct  442  EEARKGGK 449

Sequence Alignment: 28. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 92.9 bits 380,  Expect = 5e-20
 Identities = 147/430 34%, Positives = 263/430 61%, Gaps = 48/430 11%
Query  4    KEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYV 63
            K + + K+ KH+ ++  + +E Q  D     EE+ +E Q+ EG+ S+    + + +NP+ 
Sbjct  159  KHEWQHKQEKHQGKESEEEEEDQDED-----EEQDKESQESEGSESQREPRRHKNKNPFH 213
Query  64   FQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVL 123
            F  + F++  K + G V+VL+ F KRS+ L  + ++R+  + + P+T++ P H DA+ ++
Sbjct  214  FNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLI 273
Query  124  FVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMIN--RDEN-------------- 167
             +  G A +T+V  + R+S+N++ GD +R+PAGT  Y++N   DEN              
Sbjct  274  VILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNP 333
Query  168  ---EKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-F 223
               E L ++ +  PV+ PG FE+F+ +  +  +S+ + FS  +LEA+   + E++ KV F
Sbjct  334  DNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLF 393
Query  224  GE---QSKGS-------IVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQS 273
            G    Q +G        IV+ S+++IR LS+H +   R      E   P NL  + P  S
Sbjct  394  GREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRK-TISSEDK-PFNLGSRDPIYS 451
Query  274  NQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMAC 333
            N++G+L+E     + QL+DLD+ +S  ++ +G++  P++NS+A  + V+ EGE   E+  
Sbjct  452  NKLGKLFEI-TQRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVG 510
Query  334  PHLSSSSGSYQ-------KISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGN 386
                      +       K  A L    +FV PAG+PV V A+  ++L  + F +NA  N
Sbjct  511  IKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNAT--SDLNFFAFGINAENN 568
Query  387  SRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443
             R  LAG K N++++     +ELAF   ++++E + K+Q +++F     +Q+EEG +G
Sbjct  569  QRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKG 626

Sequence Alignment: 29. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 87.1 bits 353,  Expect = 1e-18
 Identities = 60/180 33%, Positives = 106/180 58%, Gaps = 10/180 5%
Query  262  PINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISV 321
            P NL  + P  S ++G+++E  P+ + QL+DLD+ +S  ++ +G++  P++NS+A  I V
Sbjct  18   PFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILV 77
Query  322  VVEGEGFFEMACPHLSSSSGSYQ-------KISARLRRGVVFVAPAGHPVAVIASQNNNL 374
            + EG+   E+            +       K  A L    +FV PAG+PV V A+  +NL
Sbjct  78   INEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT--SNL 135
Query  375  QVLCFEVNAHGNSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGP 433
              +   +NA  N R  LAG + N++++     +ELAF   ++ VE+++KNQ +++F    
Sbjct  136  NFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQ 195
Query  434  NKQQEEGGRG 443
              ++EEG +G
Sbjct  196  PNEKEEGNKG 205

Sequence Alignment: 30. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 65.8 bits 261,  Expect = 6e-12
 Identities = 109/385 28%, Positives = 199/385 51%, Gaps = 65/385 16%
Query  45   EGNSSEESYGKEQEENPYVFQDEHF----ESR--VKTEEGRVQVLENFTKRSRLLSGIEN 98
            +G   E    + +E+ P   +D  +     S+  +KT+ G V+++  +  R         
Sbjct  31   QGRGMEGREKRVEEKAPRSPEDRGLFILRRSKEVLKTDAGEVRLMMGYRYR----GNHSP 86
Query  99   FRLAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTP 158
              +  +   P+T+  P + DA L+LFV +G A +  + + K     ++ G +  IPAG+ 
Sbjct  87   MHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSS 146
Query  159  VYMINRDENEKLFIV---KILQPVSAPGHF-EAFYGAGGEDPESFYRAFSWEVLEAALKV 214
             Y++N D++E+L I+     L+ +   G + ++FY  GG  P S    F    L AA+ V
Sbjct  147  FYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNV 206
Query  215  RREQLEKVFGEQSKGSIVKAS------REKIRALSQ------------------HEEGPP 250
              +QLE ++  Q  G I++ +      R+ + ++ Q                   E+   
Sbjct  207  SSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEED 266
Query  251  RIWPF--------G-GE-----------SSGPINLLHKHPSQSNQFGRLYEAHPDDHKQL 290
             +W +        G G+           S G  NL    PS  N +G        D+  L
Sbjct  267  DVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSAL 326
Query  291  QDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARL 350
            +  +L V + N+  G+M  P+ N  AT+  +++ G G  ++  P+ +++      ++A++
Sbjct  327  KHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPNGTAA------MNAKV 380
Query  351  RRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAF 410
              G VF  P   P   IAS    L+ + F  +A  N    L GK ++++         AF
Sbjct  381  SEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGKSSLLHSMRGPELAAAF 440
Query  411  NLPSREVERIFKNQDQAFFFP-GPNKQQEE 439
             +   ++ERI K Q +A  +P  P+++ EE
Sbjct  441  GVSEEQLERIVKAQREAVILPTSPHREMEE 470

Sequence Alignment: 31. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 51.9 bits 200,  Expect = 8e-08
 Identities = 93/351 26%, Positives = 189/351 53%, Gaps = 56/351 15%
Query  71   SRV-KTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGR 129
            +RV KT+ G ++VL+  +   R++    +  +  +   P ++  P ++D+ L++F+ +G 
Sbjct  43   TRVFKTDAGEMRVLK--SHGGRIF--YRHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGE 98
Query  130  ATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPG--HFEA 187
            A +  + +++     ++ GD+  IP+G+  Y++N  E ++L ++  + P ++ G   F++
Sbjct  99   AKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQS 158
Query  188  FYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIV--------------- 232
            FY  GG +  S    F   +LE A+   R  +E++F ++  G I+               
Sbjct  159  FYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFL 218
Query  233  ---KASREK-IRALSQHEE------GPPRIWP------FGG--------ESSG-PI--NL 265
               K  +E+ ++ + Q +E         R W       FG         +++G P   NL
Sbjct  219  QLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNL 278
Query  266  LH-KHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVE 324
               K     N +G     H  ++  L + D+ V +  ++ GSM  P+ N  + + ++V+ 
Sbjct  279  YDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLS 338
Query  325  GEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAH 384
            G G  E+   H+   +GS + +  ++++G VFV P   P   +AS++  L+ + F  +A 
Sbjct  339  GYG--EL---HIGYPNGS-RAMKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSAR 392
Query  385  GNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFP 431
             N    LAG  +++  +       AF +    + R    Q +A  +P
Sbjct  393  KNKPQFLAGAASLLRTLMGPELSAAFGVSEDTLRRAVDAQHEAVILP 439

Sequence Alignment: 32. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 44.6 bits 168,  Expect = 1e-05
 Identities = 84/299 28%, Positives = 148/299 49%, Gaps = 73/299 24%
Query  127  KGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFE 186
            KG+++    R +K   F    GD+I +P G   +M N +E+  +  V ++   S   +++
Sbjct  117  KGQSSRPQDRHQKIYHF--REGDLIAVPTGFAYWMYN-NEDTPVVAVSLIDTNSFQNQLD 173
Query  187  A----FYGAGGEDPE-----------------------------SFYRAFSWEVLEAALK 213
                 FY AG ++ E                             S    F+ E LE A+ 
Sbjct  174  QMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFV 233
Query  214  VRREQLEKVFGE---QSKG---------SIVKASREKIRALSQHEEGPP--------RIW 253
            V R+ + K+ GE   + KG         S++    E+ +   + EE P         +  
Sbjct  234  VDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQ 293
Query  254  PFGG--ESSGPINLLHK-----HPSQSN-QFGRLYEAHPDDHKQLQDLDLMVSFANITKG 305
               G  E+   + L H       P   N Q G +  A   D   L  L L   F ++ K 
Sbjct  294  SRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKN 353
Query  306  SMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPAGHPVA 365
            +M  P+YN  A  I   + G  + ++       +    +     L+ G V++ P    VA
Sbjct  354  AMFVPHYNLNANSIIYALNGRALVQVV------NCNGERVFDGELQEGQVLIVPQNFAVA 407
Query  366  VIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERIFKNQD 425
               SQ++N++ + F+ N    S   LAG  +++N +  +  +  FNL  ++  ++  N  
Sbjct  408  A-RSQSDNFEYVSFKTNDRP-SIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNP 465
Query  426  QAFFFPGPNKQQ 437
             +F+ P P + Q
Sbjct  466  FSFLVP-PKESQ 476

Sequence Alignment: 33. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 43.9 bits 165,  Expect = 2e-05
 Identities = 86/300 28%, Positives = 150/300 50%, Gaps = 84/300 28%
Query  127  KGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFE 186
            +G+++    R +K   +N   GD+I +P G   +M N +E+  +  V I+   S   +++
Sbjct  120  RGQSSRPQDRHQK--IYNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSIIDTNSLENQLD 176
Query  187  A----FYGAGGEDPE---------------------------SFYRAFSWEVLEAALKVR 215
                 FY AG ++ E                           S    F+ E LE A+ V 
Sbjct  177  QMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD 236
Query  216  REQLEKVFGE---QSKG---------SIVKASREKIRALSQHEE-----------GPPR- 251
            ++  + + GE   + KG         S++K   ++ +   Q EE           G  + 
Sbjct  237  KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKH 296
Query  252  -IWPFGGESSGPIN----------LLHK-----HPSQSN-QFGRLYEAHPDDHKQLQDLD 294
               P G +S    N          L H       P   N Q G +  A   D   L  L 
Sbjct  297  CQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLR 356
Query  295  LMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGV 354
            L   F ++ K +M  P+YN  A  I   + G  + ++       +    +     L+ G 
Sbjct  357  LSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVV------NCNGERVFDGELQEGR 410
Query  355  VFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPS 414
            V++ P    VA   SQ++N++ + F+ N        LAG  +++N +  +  +  FNL S
Sbjct  411  VLIVPQNFVVAA-RSQSDNFEYVSFKTNDTPMIG-TLAGANSLLNALPEEVIQHTFNLKS 468
Query  415  REVERIFKNQDQAFFFPGPNKQQE 438
            ++  +I  N    F+ P P + Q+
Sbjct  469  QQARQIKNNNPFKFLVP-PQESQK 491

Sequence Alignment: 34. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 43.9 bits 165,  Expect = 2e-05
 Identities = 86/300 28%, Positives = 150/300 50%, Gaps = 84/300 28%
Query  127  KGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFE 186
            +G+++    R +K   +N   GD+I +P G   +M N +E+  +  V I+   S   +++
Sbjct  120  RGQSSRPQDRHQK--IYNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSIIDTNSLENQLD 176
Query  187  A----FYGAGGEDPE---------------------------SFYRAFSWEVLEAALKVR 215
                 FY AG ++ E                           S    F+ E LE A+ V 
Sbjct  177  QMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD 236
Query  216  REQLEKVFGE---QSKG---------SIVKASREKIRALSQHEE-----------GPPR- 251
            ++  + + GE   + KG         S++K   ++ +   Q EE           G  + 
Sbjct  237  KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKH 296
Query  252  -IWPFGGESSGPIN----------LLHK-----HPSQSN-QFGRLYEAHPDDHKQLQDLD 294
               P G +S    N          L H       P   N Q G +  A   D   L  L 
Sbjct  297  CQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLR 356
Query  295  LMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGV 354
            L   F ++ K +M  P+YN  A  I   + G  + ++       +    +     L+ G 
Sbjct  357  LSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVV------NCNGERVFDGELQEGR 410
Query  355  VFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPS 414
            V++ P    VA   SQ++N++ + F+ N        LAG  +++N +  +  +  FNL S
Sbjct  411  VLIVPQNFVVAA-RSQSDNFEYVSFKTNDTPMIG-TLAGANSLLNALPEEVIQHTFNLKS 468
Query  415  REVERIFKNQDQAFFFPGPNKQQE 438
            ++  +I  N    F+ P P + Q+
Sbjct  469  QQARQIKNNNPFKFLVP-PQESQK 491

Sequence Alignment: 35. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 43.7 bits 164,  Expect = 3e-05
 Identities = 39/154 25%, Positives = 73/154 47%, Gaps = 9/154 5%
Query  275  QFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACP 334
            Q G +  A   D   L  L L   + ++ K +M  P+Y   A  I   + G  + ++   
Sbjct  327  QAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVV-- 384
Query  335  HLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGK 394
                +    +     L+ G V++ P    VA   SQ++N++ + F+ N    S   LAG 
Sbjct  385  ----NCNGERVFDGELQEGGVLIVPQNFAVAA-KSQSDNFEYVSFKTNDRP-SIGNLAGA 438
Query  395  GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQ 437
             +++N +  +  +  FNL S++  ++  N   +F+ P P + Q
Sbjct  439  NSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVP-PQESQ 480

Sequence Alignment: 36. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 43.7 bits 164,  Expect = 3e-05
 Identities = 39/154 25%, Positives = 73/154 47%, Gaps = 9/154 5%
Query  275  QFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACP 334
            Q G +  A   D   L  L L   + ++ K +M  P+Y   A  I   + G  + ++   
Sbjct  327  QAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVV-- 384
Query  335  HLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGK 394
                +    +     L+ G V++ P    VA   SQ++N++ + F+ N    S   LAG 
Sbjct  385  ----NCNGERVFDGELQEGGVLIVPQNFAVAA-KSQSDNFEYVSFKTNDRP-SIGNLAGA 438
Query  395  GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQ 437
             +++N +  +  +  FNL S++  ++  N   +F+ P P + Q
Sbjct  439  NSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVP-PQESQ 480

Sequence Alignment: 37. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 40.7 bits 151,  Expect = 0.0002
 Identities = 50/210 23%, Positives = 106/210 50%, Gaps = 15/210 7%
Query  17   RDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYVFQDEHFESRVKTE 76
            R ER   E +R++ ++   E+ RERQ+ +G    +  G E+      ++ E+  +R + +
Sbjct  284  RPERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLR-ENICTRSRAD 342
Query  77   EGRVQVLENFTKRSRLLSGIENFRLAILEANPHT---FISPAHFDAELVLFVAKGRATIT 133
                QV    T  S  L  +  ++L+    + +    ++   +++A  V++  +GRA + 
Sbjct  343  IYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQ 402
Query  134  MVREEKRESFNVE--HGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGA 191
            +V +     F+ E  +G ++ IP    V    R E+E +  V      +A  +   + G 
Sbjct  403  VVDDNGNTVFDDELRQGQVLTIPQNFAV--AKRAESEGFEWVAFKTNDNA--QISPLAGR 458
Query  192  GGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASR 236
                  S  RA+  +VL  A+++ RE+  ++   + + ++V++SR
Sbjct  459  -----TSAIRALPDDVLANAFQISREEARRLKYNRQETTLVRSSR 498

Sequence Alignment: 38. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 35.9 bits 130,  Expect = 0.006
 Identities = 80/295 27%, Positives = 151/295 51%, Gaps = 68/295 23%
Query  137  EEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVS----APGHFEAFYGAG 192
            ++ ++ F +  GD+I  PAG  V   + D +  L  + +    S      G+   F+ AG
Sbjct  213  DQHQKIFRIRDGDVIPSPAGV-VQWTHNDGDNDLISITLYDANSFQNQLDGNVRNFFLAG 271
Query  193  --------------------------GEDPESFYRA-----FSWEVLEAALK-VRREQLE 220
                                       +D E++  A     F  E+L+  ++ V +E + 
Sbjct  272  QSKQSREDRRSQRQTREEGSDRQSRESDDDEALLEANILTGFQDEILQEIFRNVDQETIS 331
Query  221  KVFGEQS-KGSIVKASREKIRALSQHEEG-----PPRIWPFGGESSGP----INLLHKH- 269
            K+ G+   +G IV+A   K+R   ++EE        R     G S+G      NL  K+ 
Sbjct  332  KLRGDNDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQN 391
Query  270  ---PSQSNQF----GRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVV 322
               PS+++ F    GR+   + ++   L+ + L      + K ++ GP +N  A     V
Sbjct  392  VNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYV 451
Query  323  VEGEGFFEMACPHLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVN 382
              GEG  ++      S           ++RG ++V P G  V + A +     V   E+ 
Sbjct  452  TRGEGRVQVVGDEGRSV------FDDNVQRGQILVVPQGFAVVLKAGREGLEWV---ELK 502
Query  383  AHGNS-RFPLAGKGNIVNEFERDAKELAFNLPSREVERIFKN--QDQAFFFPGPNKQQEE 439
               N+   P+AGK +++     +    ++++ ++E  R+ KN  Q+   F+P  ++ ++E
Sbjct  503  NDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRL-KNGRQEVEVFLPFQSRDEKE 561
Query  440  GGR 442
              R
Sbjct  562  RER 564

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.