The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ
DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV
TAELVGDHGVMACGTIHGQVE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD32314 Lep d 2.0202 141 931 266.9 1.4e-73
CAA58755 Lep d 2.0201 141 926 265.5 3.7e-73
P80384 Lep d 2 141 863 247.9 7.9e-68
CAD32313 Lep d 2.0102 141 858 246.5 2.1e-67
CAB76459 Gly d 2.0201 125 660 191.0 9.2e-51
CAA57160 Lep d 2.0101 98 578 168.2 5.1e-44
A6XEN9 Blo t 2.0104 142 529 154.1 1.3e-39
A6XEN8 Blo t 2.0104 142 528 153.8 1.6e-39
A6XEP2 Blo t 2.0104 142 522 152.1 5.3e-39
A6XEP1 Blo t 2.0104 142 522 152.1 5.3e-39
A6XEP3 Blo t 2.0104 142 522 152.1 5.3e-39
A6XEP6 Blo t 2.0104 142 522 152.1 5.3e-39
O02380 Tyr p 2 141 520 151.6 7.7e-39
A6XEP5 Blo t 2.0104 142 519 151.3 9.4e-39
A6XEP4 Blo t 2.0104 142 513 149.6 3e-38
A6XEP0 Blo t 2.0104 142 512 149.3 3.7e-38
BAX34757 Der f 35.0101 143 508 148.2 8.1e-38
AAQ73482 Blo t 2.0102 142 505 147.3 1.4e-37
AAQ73483 Blo t 2.0101 144 505 147.3 1.5e-37
CAB59976 Gly d 2.0101 128 493 144.1 1.2e-36
AAQ73481 Blo t 2.0103 141 449 131.6 7.7e-33
Q00855 Der f 2 146 408 120.1 2.4e-29
BAA01239 Der f 2 138 399 117.6 1.2e-28
BAA01241 Der f 2 138 391 115.4 5.9e-28
Q9TZZ2 Eur m 2 145 389 114.8 9.5e-28
CAK22338 Der p 2.0114 146 384 113.3 2.5e-27
P49278 Der p 2 146 376 111.1 1.2e-26
AAC82350 Eur m 2.0102 135 369 109.2 4.1e-26
ABA39438 Der f 2.0109 129 360 106.7 2.2e-25
AAK30133 Der f 2 170 357 105.6 6.3e-25
CAQ68249 Der p 2.0115 129 348 103.4 2.3e-24
ABA39437 Der p 2.0109 129 348 103.4 2.3e-24
ABG76195 Der f 22.0101 155 270 81.3 1.2e-17
Q28895 Can f 7.0101 149 254 76.8 2.5e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 266.9 bits 931,  Expect = 1e-73
 Identities = 141/141 100%, Positives = 141/141 100%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
Query  121  TAELVGDHGVMACGTIHGQVE 141
            TAELVGDHGVMACGTIHGQVE
Sbjct  121  TAELVGDHGVMACGTIHGQVE 141

Sequence Alignment: 2. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 265.5 bits 926,  Expect = 4e-73
 Identities = 140/141 99%, Positives = 140/141 99%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK DV
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKADV 120
Query  121  TAELVGDHGVMACGTIHGQVE 141
            TAELVGDHGVMACGTIHGQVE
Sbjct  121  TAELVGDHGVMACGTIHGQVE 141

Sequence Alignment: 3. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 247.9 bits 863,  Expect = 8e-68
 Identities = 127/141 90%, Positives = 135/141 95%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDI+GCSGDTCVIHRG+KMTL+AKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            DT KVTIKVLAKVAGTTIQVPGLETDGCK +KCP+KKGEALDF Y  TIPAITPK+K DV
Sbjct  61   DTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TAELVGDHGVMACGTIHGQVE 141
            TAEL+GDHGVMACGT+HGQVE
Sbjct  121  TAELIGDHGVMACGTVHGQVE 141

Sequence Alignment: 4. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 246.5 bits 858,  Expect = 2e-67
 Identities = 126/141 89%, Positives = 134/141 95%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDI+GCSGDTCVIHRG+KMTL+AKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            DT KVTIKVL KVAGTTIQVPGLETDGCK +KCP+KKGEALDF Y  TIPAITPK+K DV
Sbjct  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TAELVGDHGVMACGTIHGQVE 141
            TAEL+GDHGVMACGT+HGQVE
Sbjct  121  TAELIGDHGVMACGTVHGQVE 141

Sequence Alignment: 5. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 191.0 bits 660,  Expect = 9e-51
 Identities = 95/125 76%, Positives = 106/125 84%, Gaps = 0/125 0%
Query  17   GKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
            GKM FKDCG GEVTELDI+ CSGD CVIHRG+ +TL+AKFAANQDT K TIKVLAKVAGT
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDVTAELVGDHGVMACGTI 136
             IQVPGLETDGCK +KCPIKKG+ +DF Y  T+PAI PK+K +VTAELVGDHGV+ACG  
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
Query  137  HGQVE 141
              QVE
Sbjct  121  GRQVE 125

Sequence Alignment: 6. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 168.2 bits 578,  Expect = 5e-44
 Identities = 85/98 86%, Positives = 92/98 93%, Gaps = 0/98 0%
Query  44   IHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDF 103
            IHRG+KMTL+AKFAANQDT KVTIKVLAKVAGTTIQVPGLETDGCK +KCP+KKGEALDF
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  104  NYGMTIPAITPKIKVDVTAELVGDHGVMACGTIHGQVE 141
             Y  TIPAITPK+K DVTAEL+GDHGVMACGT+HGQVE
Sbjct  61   IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE 98

Sequence Alignment: 7. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 154.1 bits 529,  Expect = 1e-39
 Identities = 72/140 51%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A + G  + VPG++ DGCK   CP+KKG+  +++Y + IP + P +K   
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 8. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 153.8 bits 528,  Expect = 2e-39
 Identities = 73/140 52%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A + G  + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 9. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 152.1 bits 522,  Expect = 5e-39
 Identities = 72/140 51%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 10. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 152.1 bits 522,  Expect = 5e-39
 Identities = 72/140 51%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 152.1 bits 522,  Expect = 5e-39
 Identities = 72/140 51%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 152.1 bits 522,  Expect = 5e-39
 Identities = 72/140 51%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 13. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 151.6 bits 520,  Expect = 8e-39
 Identities = 68/140 48%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  2    MKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQD 61
            MKF+ LFALVAVA+AG++ F DCG  E+  + + GC GD CVIH+ + + + A+F ANQD
Sbjct  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
Query  62   TNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDVT 121
            T K+ +KV  ++ G  + +PG+ETDGCKVLKCP+KKG     NY + +P++ P IK  V 
Sbjct  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
Query  122  AELVGDHGVMACGTIHGQVE 141
                G+HGV+ACG ++  V+
Sbjct  121  LLATGEHGVLACGAVNTDVK 140

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 151.3 bits 519,  Expect = 9e-39
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+S CSGD C IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A + G  + VPG++ DGCK   CP+KKG+  +++Y + IP + P +K   
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 149.6 bits 513,  Expect = 3e-38
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCS D C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 149.3 bits 512,  Expect = 4e-38
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+I +G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 17. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 148.2 bits 508,  Expect = 8e-38
 Identities = 67/140 47%, Positives = 99/140 70%, Gaps = 1/140 0%
Query  1    MMKFIALFALV-AVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAAN 59
            M+KF+ +FAL  AVASAGKM F DCGH EV  LD+SGC GD CV+H+G+ + LD K  +N
Sbjct  1    MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSN 60
Query  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVD 119
            QD+  + + + A V G  I+VPG++ DGC  ++CPI KG+  D  Y   +PA+ P IK  
Sbjct  61   QDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGT 120
Query  120  VTAELVGDHGVMACGTIHGQV 140
            +TA+++GD+G++ C  ++G++
Sbjct  121  LTAKVIGDNGLVGCLKLNGEI 141

Sequence Alignment: 18. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 147.3 bits 505,  Expect = 1e-37
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+ A+ G + F  C HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 19. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 147.3 bits 505,  Expect = 1e-37
 Identities = 71/140 50%, Positives = 98/140 70%, Gaps = 2/140 1%
Query  1    MMKFI--ALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAA 58
            M KFI  AL+ + + A+AG + F DC HGEVT LD+SGCSGD C+IH+G+  TL   F A
Sbjct  1    MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIA 60
Query  59   NQDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKV 118
            NQD+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K 
Sbjct  61   NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT 120
Query  119  DVTAELVGDHGVMACGTIHGQV 140
              TA LVGDHGV+ACG ++ +V
Sbjct  121  VTTASLVGDHGVVACGKVNTEV 142

Sequence Alignment: 20. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 144.1 bits 493,  Expect = 1e-36
 Identities = 68/125 54%, Positives = 93/125 74%, Gaps = 2/125 1%
Query  17   GKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
            GKM F DCGH E+ EL +S C+G+ CVIHRG+ +TLDAKF ANQDT  V + + A + G 
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  77   -TIQVPGLETDGCKVLKCPIKKGEALDFNYGM-TIPAITPKIKVDVTAELVGDHGVMACG 134
              I +PGLET+ CK++KCPI+KGE  ++ Y +  IP  TP+IK  V A+L+G+HGV+ACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  135  TIHGQVE 141
             + G+V+
Sbjct  121  WVDGEVQ 127

Sequence Alignment: 21. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 131.6 bits 449,  Expect = 8e-33
 Identities = 65/139 46%, Positives = 90/139 64%, Gaps = 1/139 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
            M KFI L  LV+        ++ C   EVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MFKFICLALLVSSRRQRCQIYRSCTW-EVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 59
Query  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  60   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 119
Query  121  TAELVGDHGVMACGTIHGQV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  120  TASLVGDHGVVACGKVNTEV 139

Sequence Alignment: 22. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 120.1 bits 408,  Expect = 2e-29
 Identities = 59/138 42%, Positives = 88/138 63%, Gaps = 3/138 2%
Query  3    KFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQD 61
            K + L  LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+
Sbjct  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
Query  62   TNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDV 120
            T    I++ A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V V
Sbjct  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  121  TAELVGDHGVMACG-TIHGQV 140
            T +L+GD+GV+AC    HG++
Sbjct  124  TVKLIGDNGVLACAIATHGKI 144

Sequence Alignment: 23. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 117.6 bits 399,  Expect = 1e-28
 Identities = 57/131 43%, Positives = 85/131 64%, Gaps = 3/131 2%
Query  10   LVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIK 68
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I+
Sbjct  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
Query  69   VLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGD 127
            + A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V VT +L+GD
Sbjct  63   IKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGD 122
Query  128  HGVMACG-TIHGQV 140
            +GV+AC    HG++
Sbjct  123  NGVLACAIATHGKI 136

Sequence Alignment: 24. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 115.4 bits 391,  Expect = 6e-28
 Identities = 57/131 43%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  10   LVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIK 68
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I+
Sbjct  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
Query  69   VLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGD 127
            + A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V VT +LVGD
Sbjct  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGD 122
Query  128  HGVMACG-TIHGQV 140
            +GV+AC    H ++
Sbjct  123  NGVLACAIATHAKI 136

Sequence Alignment: 25. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 114.8 bits 389,  Expect = 9e-28
 Identities = 57/140 40%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + CVIHRG    L+A F AN
Sbjct  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
Query  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-V 118
            Q++N   I++ A + G  I VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V
Sbjct  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
Query  119  DVTAELVGDHGVMACG-TIHGQV 140
             VT +L+GD+GV+AC    H ++
Sbjct  121  VVTVKLLGDNGVLACAIATHAKI 143

Sequence Alignment: 26. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 113.3 bits 384,  Expect = 3e-27
 Identities = 54/140 38%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F AN
Sbjct  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
Query  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-V 118
            Q+T    I++ A + G  + VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V
Sbjct  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  119  DVTAELVGDHGVMACG-TIHGQV 140
             VT +++GD+GV+AC    H ++
Sbjct  122  VVTVKVLGDNGVLACAIATHAKI 144

Sequence Alignment: 27. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 111.1 bits 376,  Expect = 1e-26
 Identities = 53/140 37%, Positives = 85/140 60%, Gaps = 3/140 2%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
            M K + L  LVA  +  ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F AN
Sbjct  2    MYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEAN 61
Query  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-V 118
            Q+T    I++ A + G  + VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V
Sbjct  62   QNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  119  DVTAELVGDHGVMACG-TIHGQV 140
             VT +++GD GV+AC    H ++
Sbjct  122  VVTVKVMGDDGVLACAIATHAKI 144

Sequence Alignment: 28. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 109.2 bits 369,  Expect = 4e-26
 Identities = 53/130 40%, Positives = 82/130 63%, Gaps = 3/130 2%
Query  11   VAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKV 69
            VA  +A ++  KDC + E+ ++ + GC G + CVIHRG    L+A F ANQ++N   I++
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  70   LAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDH 128
             A + G  I VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V VT +L+GD+
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  129  GVMACG-TIHGQV 140
            GV+AC    H ++
Sbjct  121  GVLACAIATHAKI 133

Sequence Alignment: 29. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 106.7 bits 360,  Expect = 2e-25
 Identities = 50/123 40%, Positives = 79/123 64%, Gaps = 3/123 2%
Query  18   KMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
            ++  KDC + E+ ++ + G  G D C+IHRG+  TL+A F ANQ+T    I++ A + G 
Sbjct  2    QVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGL 61
Query  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG- 134
             + VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V VT +L+GD+GV+AC  
Sbjct  62   EVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAI 121
Query  135  TIHGQV 140
              H ++
Sbjct  122  ATHAKI 127

Sequence Alignment: 30. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 105.6 bits 357,  Expect = 6e-25
 Identities = 50/122 40%, Positives = 78/122 63%, Gaps = 3/122 2%
Query  19   MTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGTT 77
            + +    + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I++ A + G  
Sbjct  44   LVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLE 103
Query  78   IQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG-T 135
            I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V VT +L+GD+GV+AC   
Sbjct  104  IDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIA 163
Query  136  IHGQV 140
             HG++
Sbjct  164  THGKI 168

Sequence Alignment: 31. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 103.4 bits 348,  Expect = 2e-24
 Identities = 46/123 37%, Positives = 78/123 63%, Gaps = 3/123 2%
Query  18   KMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
            ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F ANQ++    I++ A + G 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG- 134
             + VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V VT +++GD+GV+AC  
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACAI 121
Query  135  TIHGQV 140
              H ++
Sbjct  122  ATHAKI 127

Sequence Alignment: 32. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 103.4 bits 348,  Expect = 2e-24
 Identities = 46/123 37%, Positives = 78/123 63%, Gaps = 3/123 2%
Query  18   KMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
            ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F ANQ++    I++ A + G 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG- 134
             + VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V VT +++GD+GV+AC  
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAI 121
Query  135  TIHGQV 140
              H ++
Sbjct  122  ATHAKI 127

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 81.3 bits 270,  Expect = 1e-17
 Identities = 50/130 38%, Positives = 78/130 60%, Gaps = 15/130 11%
Query  5    IALFALVAVASAGK--MTFKDCGHGEVTELDISGCSGD--TCVIHRGQKMTLDAKFAANQ 60
            +ALF L A   A +  + +KDCGH E+  + ++G + +  +CVIH+  K  L   F AN+
Sbjct  9    MALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANE 68
Query  61   DT-NKVTIKVLAKVAGTTIQVPGLE-TDGCKV--LKCPIKKGEA----LDFNYGMTIPAI 112
            +T NK+  + +  + G  +  PG++ TD C+   L CP+ KG+     LDFN G  +P  
Sbjct  69   NTGNKINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVP-- 126
Query  113  TPKIKVDVTAELVGDHGVMACGTIH 137
            T  +   V  E  G  G + CG +H
Sbjct  127  TANVTATVRLE-NGHGGDLLCGRMH 150

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 76.8 bits 254,  Expect = 3e-16
 Identities = 45/141 31%, Positives = 73/141 51%, Gaps = 7/141 4%
Query  1    MMKFIALFALVAVAS---AGKMTFKDCGH--GEVTELDISGCSGDTCVIHRGQKMTLDAK 55
            M  ++A F L+A+      G + FKDCG   G + EL+++ C    C +H+GQ  +++  
Sbjct  1    MRLLVAAFLLLALGDLGPGGAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVT 60
Query  56   FAANQDTNKVTIKVLAKVAGTTIQVPGLETDGCKV-LKCPIKKGEALDFNYGMTIPAITP 114
            F +N  +      V   V G  +  P  E DGCK  + CPI+K +   +   + +    P
Sbjct  61   FTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYP 120
Query  115  KIKVDVTAELVGDHGV-MACGTIHGQVE 141
             IK+ V   L+GD+   + C  I  Q+E
Sbjct  121  SIKLVVQWMLLGDNNQHLFCWEIPVQIE 148

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.