The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ
DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV
TAELIGDHGVMACGTVHGQVE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD32313 Lep d 2.0102 141 925 255.5 3.9e-70
P80384 Lep d 2 141 920 254.2 9.9e-70
CAA58755 Lep d 2.0201 141 863 238.8 4.1e-65
CAD32314 Lep d 2.0202 141 858 237.5 1.1e-64
CAB76459 Gly d 2.0201 125 676 188.5 5.1e-50
CAA57160 Lep d 2.0101 98 632 176.8 1.3e-46
A6XEN9 Blo t 2.0104 142 516 145.4 5.6e-37
A6XEN8 Blo t 2.0104 142 513 144.6 9.9e-37
A6XEP2 Blo t 2.0104 142 507 142.9 3e-36
A6XEP1 Blo t 2.0104 142 507 142.9 3e-36
A6XEP3 Blo t 2.0104 142 507 142.9 3e-36
A6XEP6 Blo t 2.0104 142 507 142.9 3e-36
A6XEP5 Blo t 2.0104 142 506 142.7 3.7e-36
CAB59976 Gly d 2.0101 128 503 141.9 5.5e-36
BAX34757 Der f 35.0101 143 501 141.3 9.4e-36
A6XEP4 Blo t 2.0104 142 498 140.5 1.6e-35
A6XEP0 Blo t 2.0104 142 497 140.3 2e-35
O02380 Tyr p 2 141 496 140.0 2.3e-35
AAQ73482 Blo t 2.0102 142 490 138.4 7.2e-35
AAQ73483 Blo t 2.0101 144 490 138.4 7.4e-35
AAQ73481 Blo t 2.0103 141 434 123.3 2.5e-30
Q00855 Der f 2 146 408 116.3 3.3e-28
BAA01239 Der f 2 138 403 115.0 7.9e-28
BAA01241 Der f 2 138 389 111.2 1.1e-26
CAK22338 Der p 2.0114 146 385 110.1 2.4e-26
Q9TZZ2 Eur m 2 145 384 109.8 2.9e-26
P49278 Der p 2 146 373 106.8 2.3e-25
ABA39438 Der f 2.0109 129 364 104.5 1e-24
AAC82350 Eur m 2.0102 135 364 104.5 1.1e-24
AAK30133 Der f 2 170 357 102.5 5.6e-24
CAQ68249 Der p 2.0115 129 345 99.4 3.6e-23
ABA39437 Der p 2.0109 129 345 99.4 3.6e-23
ABG76195 Der f 22.0101 155 247 72.9 4.1e-15
Q28895 Can f 7.0101 149 241 71.3 1.2e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 255.5 bits 925,  Expect = 4e-70
 Identities = 141/141 100%, Positives = 141/141 100%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV
Sbjct  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TAELIGDHGVMACGTVHGQVE 141
            TAELIGDHGVMACGTVHGQVE
Sbjct  121  TAELIGDHGVMACGTVHGQVE 141

Sequence Alignment: 2. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 254.2 bits 920,  Expect = 1e-69
 Identities = 140/141 99%, Positives = 140/141 99%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            DTAKVTIKVL KVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV
Sbjct  61   DTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TAELIGDHGVMACGTVHGQVE 141
            TAELIGDHGVMACGTVHGQVE
Sbjct  121  TAELIGDHGVMACGTVHGQVE 141

Sequence Alignment: 3. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 238.8 bits 863,  Expect = 4e-65
 Identities = 127/141 90%, Positives = 135/141 95%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDI+GCSGDTCVIHRG+KMTL+AKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            DT KVTIKVL KVAGTTIQVPGLETDGCK +KCP+KKGEALDF Y  TIPAITPK+KADV
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKADV 120
Query  121  TAELIGDHGVMACGTVHGQVE 141
            TAEL+GDHGVMACGT+HGQVE
Sbjct  121  TAELVGDHGVMACGTIHGQVE 141

Sequence Alignment: 4. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 237.5 bits 858,  Expect = 1e-64
 Identities = 126/141 89%, Positives = 134/141 95%, Gaps = 0/141 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            MMKFIALFALVAVASAGKMTFKDCGHGEVTELDI+GCSGDTCVIHRG+KMTL+AKFAANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            DT KVTIKVL KVAGTTIQVPGLETDGCK +KCP+KKGEALDF Y  TIPAITPK+K DV
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
Query  121  TAELIGDHGVMACGTVHGQVE 141
            TAEL+GDHGVMACGT+HGQVE
Sbjct  121  TAELVGDHGVMACGTIHGQVE 141

Sequence Alignment: 5. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 188.5 bits 676,  Expect = 5e-50
 Identities = 97/125 77%, Positives = 108/125 86%, Gaps = 0/125 0%
Query  17   GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
            GKM FKDCG GEVTELDIT CSGD CVIHRG+ +TLEAKFAANQDT K TIKVL KVAGT
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTV 136
             IQVPGLETDGCKF+KCP+KKG+ +DF Y+ T+PAI PKVKA+VTAEL+GDHGV+ACG  
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
Query  137  HGQVE 141
              QVE
Sbjct  121  GRQVE 125

Sequence Alignment: 6. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 176.8 bits 632,  Expect = 1e-46
 Identities = 97/98 98%, Positives = 97/98 98%, Gaps = 0/98 0%
Query  44   IHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 103
            IHRGEKMTLEAKFAANQDTAKVTIKVL KVAGTTIQVPGLETDGCKFIKCPVKKGEALDF
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  104  IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE 141
            IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE
Sbjct  61   IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE 98

Sequence Alignment: 7. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 145.4 bits 516,  Expect = 6e-37
 Identities = 72/140 51%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   + G  + VPG++ DGCK   CP+KKG+  ++ YS  IP + P VK   
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 8. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 144.6 bits 513,  Expect = 1e-36
 Identities = 72/140 51%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   + G  + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 9. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 142.9 bits 507,  Expect = 3e-36
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 10. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 142.9 bits 507,  Expect = 3e-36
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 142.9 bits 507,  Expect = 3e-36
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 142.9 bits 507,  Expect = 3e-36
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 13. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 142.7 bits 506,  Expect = 4e-36
 Identities = 71/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++ CSGD C IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   + G  + VPG++ DGCK   CP+KKG+  ++ YS  IP + P VK   
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 14. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 141.9 bits 503,  Expect = 6e-36
 Identities = 69/125 55%, Positives = 96/125 76%, Gaps = 2/125 1%
Query  17   GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
            GKM F DCGH E+ EL ++ C+G+ CVIHRG+ +TL+AKF ANQDTA V + +   + G 
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  77   -TIQVPGLETDGCKFIKCPVKKGEALDFIYS-GTIPAITPKVKADVTAELIGDHGVMACG 134
              I +PGLET+ CK++KCP++KGE  ++IY+ G IP  TP++KA V A+LIG+HGV+ACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  135  TVHGQVE 141
             V G+V+
Sbjct  121  WVDGEVQ 127

Sequence Alignment: 15. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 141.3 bits 501,  Expect = 9e-36
 Identities = 64/140 45%, Positives = 100/140 71%, Gaps = 1/140 0%
Query  1    MMKFIALFALV-AVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAAN 59
            M+KF+ +FAL  AVASAGKM F DCGH EV  LD++GC GD CV+H+G+ + L+ K  +N
Sbjct  1    MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSN 60
Query  60   QDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKAD 119
            QD+  + + +   V G  I+VPG++ DGC +++CP+ KG+  D  YS  +PA+ P +K  
Sbjct  61   QDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGT 120
Query  120  VTAELIGDHGVMACGTVHGQV 140
            +TA++IGD+G++ C  ++G++
Sbjct  121  LTAKVIGDNGLVGCLKLNGEI 141

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 140.5 bits 498,  Expect = 2e-35
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCS D C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 140.3 bits 497,  Expect = 2e-35
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+I +G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 18. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 140.0 bits 496,  Expect = 2e-35
 Identities = 66/140 47%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  2    MKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQD 61
            MKF+ LFALVAVA+AG++ F DCG  E+  + + GC GD CVIH+ + + + A+F ANQD
Sbjct  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
Query  62   TAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVT 121
            T K+ +KV  ++ G  + +PG+ETDGCK +KCP+KKG      YS  +P++ P +K  V 
Sbjct  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
Query  122  AELIGDHGVMACGTVHGQVE 141
                G+HGV+ACG V+  V+
Sbjct  121  LLATGEHGVLACGAVNTDVK 140

Sequence Alignment: 19. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 138.4 bits 490,  Expect = 7e-35
 Identities = 69/140 49%, Positives = 94/140 67%, Gaps = 0/140 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+ A+ G + F  C HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TASLVGDHGVVACGKVNTEV 140

Sequence Alignment: 20. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 138.4 bits 490,  Expect = 7e-35
 Identities = 70/140 50%, Positives = 97/140 69%, Gaps = 2/140 1%
Query  1    MMKFI--ALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAA 58
            M KFI  AL+ + + A+AG + F DC HGEVT LD++GCSGD C+IH+G+  TL+  F A
Sbjct  1    MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIA 60
Query  59   NQDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKA 118
            NQD+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K 
Sbjct  61   NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT 120
Query  119  DVTAELIGDHGVMACGTVHGQV 140
              TA L+GDHGV+ACG V+ +V
Sbjct  121  VTTASLVGDHGVVACGKVNTEV 142

Sequence Alignment: 21. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 123.3 bits 434,  Expect = 2e-30
 Identities = 64/139 46%, Positives = 89/139 64%, Gaps = 1/139 0%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
            M KFI L  LV+        ++ C   EVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MFKFICLALLVSSRRQRCQIYRSCTW-EVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 59
Query  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  60   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 119
Query  121  TAELIGDHGVMACGTVHGQV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  120  TASLVGDHGVVACGKVNTEV 139

Sequence Alignment: 22. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 116.3 bits 408,  Expect = 3e-28
 Identities = 60/138 43%, Positives = 88/138 63%, Gaps = 3/138 2%
Query  3    KFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQD 61
            K + L  LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+
Sbjct  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
Query  62   TAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADV 120
            T    I++   + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   V
Sbjct  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  121  TAELIGDHGVMACG-TVHGQV 140
            T +LIGD+GV+AC    HG++
Sbjct  124  TVKLIGDNGVLACAIATHGKI 144

Sequence Alignment: 23. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 115.0 bits 403,  Expect = 8e-28
 Identities = 58/131 44%, Positives = 85/131 64%, Gaps = 3/131 2%
Query  10   LVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIK 68
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I+
Sbjct  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
Query  69   VLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGD 127
            +   + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +LIGD
Sbjct  63   IKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGD 122
Query  128  HGVMACG-TVHGQV 140
            +GV+AC    HG++
Sbjct  123  NGVLACAIATHGKI 136

Sequence Alignment: 24. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 111.2 bits 389,  Expect = 1e-26
 Identities = 56/131 42%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  10   LVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIK 68
            LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I+
Sbjct  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
Query  69   VLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGD 127
            +   + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +L+GD
Sbjct  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGD 122
Query  128  HGVMACG-TVHGQV 140
            +GV+AC    H ++
Sbjct  123  NGVLACAIATHAKI 136

Sequence Alignment: 25. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 110.1 bits 385,  Expect = 2e-26
 Identities = 53/140 37%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F AN
Sbjct  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
Query  60   QDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
            Q+T    I++   + G  + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +  
Sbjct  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  119  DVTAELIGDHGVMACG-TVHGQV 140
             VT +++GD+GV+AC    H ++
Sbjct  122  VVTVKVLGDNGVLACAIATHAKI 144

Sequence Alignment: 26. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 109.8 bits 384,  Expect = 3e-26
 Identities = 56/140 40%, Positives = 86/140 61%, Gaps = 3/140 2%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + CVIHRG    LEA F AN
Sbjct  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
Query  60   QDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
            Q++    I++   + G  I VPG++ + C F+KCP+ KG+  D  Y+  +P I PK +  
Sbjct  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
Query  119  DVTAELIGDHGVMACG-TVHGQV 140
             VT +L+GD+GV+AC    H ++
Sbjct  121  VVTVKLLGDNGVLACAIATHAKI 143

Sequence Alignment: 27. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 106.8 bits 373,  Expect = 2e-25
 Identities = 52/140 37%, Positives = 85/140 60%, Gaps = 3/140 2%
Query  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
            M K + L  LVA  +  ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F AN
Sbjct  2    MYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEAN 61
Query  60   QDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
            Q+T    I++   + G  + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +  
Sbjct  62   QNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  119  DVTAELIGDHGVMACG-TVHGQV 140
             VT +++GD GV+AC    H ++
Sbjct  122  VVTVKVMGDDGVLACAIATHAKI 144

Sequence Alignment: 28. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 104.5 bits 364,  Expect = 1e-24
 Identities = 51/123 41%, Positives = 79/123 64%, Gaps = 3/123 2%
Query  18   KMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
            ++  KDC + E+ ++ + G  G D C+IHRG+  TLEA F ANQ+T    I++   + G 
Sbjct  2    QVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGL 61
Query  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG- 134
             + VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +LIGD+GV+AC  
Sbjct  62   EVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAI 121
Query  135  TVHGQV 140
              H ++
Sbjct  122  ATHAKI 127

Sequence Alignment: 29. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 104.5 bits 364,  Expect = 1e-24
 Identities = 52/130 40%, Positives = 81/130 62%, Gaps = 3/130 2%
Query  11   VAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKV 69
            VA  +A ++  KDC + E+ ++ + GC G + CVIHRG    LEA F ANQ++    I++
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  70   LTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDH 128
               + G  I VPG++ + C F+KCP+ KG+  D  Y+  +P I PK +   VT +L+GD+
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  129  GVMACG-TVHGQV 140
            GV+AC    H ++
Sbjct  121  GVLACAIATHAKI 133

Sequence Alignment: 30. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 102.5 bits 357,  Expect = 6e-24
 Identities = 51/122 41%, Positives = 78/122 63%, Gaps = 3/122 2%
Query  19   MTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGTT 77
            + +    + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I++   + G  
Sbjct  44   LVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLE 103
Query  78   IQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG-T 135
            I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +LIGD+GV+AC   
Sbjct  104  IDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIA 163
Query  136  VHGQV 140
             HG++
Sbjct  164  THGKI 168

Sequence Alignment: 31. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 99.4 bits 345,  Expect = 4e-23
 Identities = 45/123 36%, Positives = 78/123 63%, Gaps = 3/123 2%
Query  18   KMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
            ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F ANQ++    I++   + G 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG- 134
             + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +   VT +++GD+GV+AC  
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACAI 121
Query  135  TVHGQV 140
              H ++
Sbjct  122  ATHAKI 127

Sequence Alignment: 32. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 99.4 bits 345,  Expect = 4e-23
 Identities = 45/123 36%, Positives = 78/123 63%, Gaps = 3/123 2%
Query  18   KMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
            ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F ANQ++    I++   + G 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG- 134
             + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +   VT +++GD+GV+AC  
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAI 121
Query  135  TVHGQV 140
              H ++
Sbjct  122  ATHAKI 127

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 72.9 bits 247,  Expect = 4e-15
 Identities = 49/130 37%, Positives = 76/130 58%, Gaps = 15/130 11%
Query  5    IALFALVAVASAGK--MTFKDCGHGEVTELDITGCSGD--TCVIHRGEKMTLEAKFAANQ 60
            +ALF L A   A +  + +KDCGH E+  + +TG + +  +CVIH+  K  L   F AN+
Sbjct  9    MALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANE 68
Query  61   DTA-KVTIKVLTKVAGTTIQVPGLE-TDGCKF--IKCPVKKGEA----LDFIYSGTIPAI 112
            +T  K+  + +  + G  +  PG++ TD C+   + CP+ KG+     LDF     +P  
Sbjct  69   NTGNKINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVP-- 126
Query  113  TPKVKADVTAELIGDHGVMACGTVH 137
            T  V A V  E  G  G + CG +H
Sbjct  127  TANVTATVRLE-NGHGGDLLCGRMH 150

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 71.3 bits 241,  Expect = 1e-14
 Identities = 42/141 29%, Positives = 70/141 49%, Gaps = 7/141 4%
Query  1    MMKFIALFALVAVAS---AGKMTFKDCGH--GEVTELDITGCSGDTCVIHRGEKMTLEAK 55
            M  ++A F L+A+      G + FKDCG   G + EL++  C    C +H+G+  ++   
Sbjct  1    MRLLVAAFLLLALGDLGPGGAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVT 60
Query  56   FAANQDTAKVTIKVLTKVAGTTIQVPGLETDGCKF-IKCPVKKGEALDFIYSGTIPAITP 114
            F +N  +      V   V G  +  P  E DGCK  I CP++K +   ++    +    P
Sbjct  61   FTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYP 120
Query  115  KVKADVTAELIGDHGV-MACGTVHGQVE 141
             +K  V   L+GD+   + C  +  Q+E
Sbjct  121  SIKLVVQWMLLGDNNQHLFCWEIPVQIE 148

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.