The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMKTLVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQ
LDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGG
QDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSAC
VKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITF
CP
Sequence Info Allergen Name Length Opt Bits Score E Value
ACE80955 Pru p 2.0301 242 1714 336.2 6e-94
P50694 Pru av 2 245 1461 288.0 1.9e-79
CAC10270 Mal d 2 246 1222 242.5 9.7e-66
ACE80957 Pru p 2.0201 246 1179 234.3 2.8e-63
ACE80959 Pru p 2.0101 246 1167 232.0 1.4e-62
Q9ARG0 Cap a 1.0101 246 479 101.0 3.8e-23
CAC34055 Cap a 1w 246 479 101.0 3.8e-23
AAG34078 Cap a 1 180 429 91.5 2e-20
P81295 Jun a 3 225 314 69.6 9.8e-14
AAR21073 Cup s 3.0101 225 307 68.3 2.5e-13
AAR21074 Cup s 3.0102 225 307 68.3 2.5e-13
CAC05258 Cup a 3 199 305 67.9 2.9e-13
1Z3Q_A Mus a 4.0101 200 251 57.6 3.6e-10
E3SU11 Ole e 13.0101 226 243 56.1 1.2e-09
P12670 Lyc e NP24 247 238 55.1 2.4e-09
P81370 Act c 2 225 227 53.0 9.5e-09
AAF80165 Jun v 3.010102 97 208 49.4 5.1e-08
AAF80167 Jun v 3.010101 97 208 49.4 5.1e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 336.2 bits 1714,  Expect = 6e-94
 Identities = 242/242 100%, Positives = 242/242 100%, Gaps = 0/242 0%
Query  1    MMKTLVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQ 60
            MMKTLVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQ
Sbjct  1    MMKTLVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQ 60
Query  61   LDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGG 120
            LDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGG
Sbjct  61   LDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGG 120
Query  121  QDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSAC 180
            QDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSAC
Sbjct  121  QDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSAC 180
Query  181  VKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITF 240
            VKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITF
Sbjct  181  VKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITF 240
Query  241  CP 242
            CP
Sbjct  241  CP 242

Sequence Alignment: 2. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 288.0 bits 1461,  Expect = 2e-79
 Identities = 204/242 84%, Positives = 215/242 88%, Gaps = 3/242 1%
Query  1    MMKTLVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGN---PQLSTTGFELASQA 57
            MMKTLV VLSLSLT+LSFGGAHAAT+SFKNNCPY VWP ++ +   PQLSTTGFELASQA
Sbjct  1    MMKTLVVVLSLSLTILSFGGAHAATISFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQA 60
Query  58   SFQLDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAA 117
            SFQLDTPVPW+GRFWART CSTDASGKFVC TADC SGQ+MCNG   IPPATLAEF I A
Sbjct  61   SFQLDTPVPWNGRFWARTGCSTDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPA 120
Query  118  GGGQDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACL 177
            GGGQDFYDVSLVDGFNLPMSVTPQGGTG CK  SC ANVN VCPSELQK GSDGSVVACL
Sbjct  121  GGGQDFYDVSLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQKKGSDGSVVACL 180
Query  178  SACVKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYL 237
            SACVKFG PQYCCTPPQ T E CPPTNYS+IFH  CPDAYSYA+DD +G FTC+GGPNY 
Sbjct  181  SACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYA 240
Query  238  ITFCP 242
            ITFCP
Sbjct  241  ITFCP 245

Sequence Alignment: 3. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 242.5 bits 1222,  Expect = 1e-65
 Identities = 167/242 69%, Positives = 194/242 80%, Gaps = 4/242 1%
Query  1    MMKTLVA-VLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASF-GN--PQLSTTGFELASQ 56
            MMK+ VA +L L+L +L F GAHAA ++F NNCP TVWP ++ G+  PQLS TGFELAS+
Sbjct  1    MMKSQVASLLGLTLAILFFSGAHAAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASK 60
Query  57   ASFQLDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIA 116
            AS  +D P PWSGRFW RTRCSTDA+GKF CETADC SGQ+ CNG   +PPATL E TIA
Sbjct  61   ASRSVDAPSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIA 120
Query  117  AGGGQDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVAC 176
            A GGQD+YDVSLVDGFNLPMSV PQGGTG CK  SC ANVN VCP+ LQ   +DGSV++C
Sbjct  121  ANGGQDYYDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISC 180
Query  177  LSACVKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNY 236
             SAC+ FG+ +YCCTPP  T E CPPT YS+IF +QCP AYSYA+DD    FTCSGGP+Y
Sbjct  181  KSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDY 240
Query  237  LITFCP 242
            +ITFCP
Sbjct  241  VITFCP 246

Sequence Alignment: 4. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 234.3 bits 1179,  Expect = 3e-63
 Identities = 161/242 66%, Positives = 189/242 78%, Gaps = 4/242 1%
Query  1    MMKTLVAVLSLS-LTLLSFGGAHAATMSFKNNCPYTVWPASF-GN--PQLSTTGFELASQ 56
            MMK+  A+L L+ L +L F GAHAA ++F N C YTVWP ++ G+  PQLS TGFELA+ 
Sbjct  1    MMKSQAALLGLTTLAILFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFELATG 60
Query  57   ASFQLDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIA 116
             S  +D P PWSGRF+ RTRCSTDASGKF C TADC SGQ+ CNG   +PPATL E TIA
Sbjct  61   ISNSVDAPSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAVPPATLVEITIA 120
Query  117  AGGGQDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVAC 176
              GGQDFYDVSLVDGFNLPMSV PQGGTG CK  +C A++N VCP+ELQ  GSDGSV+AC
Sbjct  121  ENGGQDFYDVSLVDGFNLPMSVAPQGGTGECKASTCPADINKVCPAELQVKGSDGSVIAC 180
Query  177  LSACVKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNY 236
             SAC+ + +PQYCCTPP +  E CPPT+YS++F  QCP AYSYA+DD    FTCSG P+Y
Sbjct  181  KSACLALNQPQYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDY 240
Query  237  LITFCP 242
            LITFCP
Sbjct  241  LITFCP 246

Sequence Alignment: 5. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 232.0 bits 1167,  Expect = 1e-62
 Identities = 159/242 65%, Positives = 188/242 77%, Gaps = 4/242 1%
Query  1    MMKTLVAVLSLS-LTLLSFGGAHAATMSFKNNCPYTVWPASF-GN--PQLSTTGFELASQ 56
            MMK+  A+L L+ L +L F GAHAA ++F N C YTVWP ++ G+  PQLS TGF+LA+ 
Sbjct  1    MMKSQAALLGLTTLAILFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFKLATG 60
Query  57   ASFQLDTPVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIA 116
             S  +D P PWSGRF+ RTRCSTDASGKF C TADC SGQ+ CNG    PPATL E TIA
Sbjct  61   ISRSVDAPSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIA 120
Query  117  AGGGQDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVAC 176
            + GGQDFYDVSLVDGFNLPMSV PQGGTG CK  +C A++N VCP+ LQ  GSDGSV+AC
Sbjct  121  SNGGQDFYDVSLVDGFNLPMSVAPQGGTGKCKASTCPADINKVCPAPLQVKGSDGSVIAC 180
Query  177  LSACVKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNY 236
             SAC+ F +P+YCCTPP +  E CPPT+YS++F  QCP AYSYA+DD    FTCSG P+Y
Sbjct  181  KSACLAFNQPKYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDY 240
Query  237  LITFCP 242
            LITFCP
Sbjct  241  LITFCP 246

Sequence Alignment: 6. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 101.0 bits 479,  Expect = 4e-23
 Identities = 102/215 47%, Positives = 129/215 60%, Gaps = 23/215 10%
Query  10   SLSLTLLSF-GGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS 68
            S+ L LL+F    +AAT   +NNCPYTVW AS   P     G  L    ++ ++ P P +
Sbjct  7    SFVLFLLAFVTYTYAATFEVRNNCPYTVWAAS--TP--VGGGRRLDRGQTWTINAP-PGT 61
Query  69   G--RFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDV 126
               R W RT C+ D SG+  C+T DC  G L C G  G PP TLAE+ +      DF+D+
Sbjct  62   AMARIWGRTNCNFDGSGRGSCQTGDC-GGVLQCTGW-GKPPNTLAEYALNQFNNLDFWDI 119
Query  127  SLVDGFNLPMSVTPQGGTG-TCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGE 185
            SLVDGFN+PM+  P   +G  C    C AN+N  CP  L+  G       C + C  FG 
Sbjct  120  SLVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTTFGG 173
Query  186  PQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTC-SGGPNYLITFCP 242
             QYCCT     +  C PT  S+ F ++CPDAYSY  DD    FTC SG  NY + FCP
Sbjct  174  QQYCCT-----QGPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 7. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 101.0 bits 479,  Expect = 4e-23
 Identities = 102/215 47%, Positives = 129/215 60%, Gaps = 23/215 10%
Query  10   SLSLTLLSF-GGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS 68
            S+ L LL+F    +AAT   +NNCPYTVW AS   P     G  L    ++ ++ P P +
Sbjct  7    SFVLFLLAFVTYTYAATFEVRNNCPYTVWAAS--TP--VGGGRRLDRGQTWTINAP-PGT 61
Query  69   G--RFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDV 126
               R W RT C+ D SG+  C+T DC  G L C G  G PP TLAE+ +      DF+D+
Sbjct  62   AMARIWGRTNCNFDGSGRGSCQTGDC-GGVLQCTGW-GKPPNTLAEYALNQFNNLDFWDI 119
Query  127  SLVDGFNLPMSVTPQGGTG-TCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGE 185
            SLVDGFN+PM+  P   +G  C    C AN+N  CP  L+  G       C + C  FG 
Sbjct  120  SLVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGG------CNNPCTTFGG 173
Query  186  PQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTC-SGGPNYLITFCP 242
             QYCCT     +  C PT  S+ F ++CPDAYSY  DD    FTC SG  NY + FCP
Sbjct  174  QQYCCT-----QGPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 8. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 91.5 bits 429,  Expect = 2e-20
 Identities = 83/176 47%, Positives = 107/176 60%, Gaps = 21/176 11%
Query  30   NNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS--GRFWARTRCSTDASGKFVC 87
            NNCPYTVW A+   P     G  L    S+ +  P P +   R W RT C+ D +G+  C
Sbjct  1    NNCPYTVWAAA--TP--VGGGKRLERGQSWWFWAP-PGTKMARIWGRTNCNFDGAGRGWC 55
Query  88   ETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFNLPMSVTP-QGGTGT 146
            +T DC  G L C G  G PP TLAE+ +      DF+D+S++DGFN+PMS  P + G G 
Sbjct  56   QTGDC-GGVLECKGW-GKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGK 113
Query  147  CKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTPPQETKEKCPPTNYS 206
            C    C AN+N  CP  L+  G       C + C  FG  QYCCT     +  C PT+ S
Sbjct  114  CHPIQCVANINGECPGSLRVPG------GCNNPCTTFGGQQYCCT-----QGPCGPTDLS 162
Query  207  QIFHEQCPDAYSYAFDD 223
            + F ++CPDAYSY  DD
Sbjct  163  RFFKQRCPDAYSYPQDD 179

Sequence Alignment: 9. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 69.6 bits 314,  Expect = 1e-13
 Identities = 107/214 50%, Positives = 132/214 61%, Gaps = 25/214 11%
Query  5    LVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTP 64
            L A L++SL +   G         KN C YTVW A      L   G  L    ++ ++  
Sbjct  11   LAATLAISLHMQEAG---VVKFDIKNQCGYTVWAAG-----LPGGGKRLDQGQTWTVNLA 62
Query  65   V-PWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDF 123
                S RFW RT C+ DASGK  C+T DC  GQL C   +G  PATLAE+T +    QD+
Sbjct  63   AGTASARFWGRTGCTFDASGKGSCQTGDC-GGQLSCT-VSGAVPATLAEYTQS---DQDY 117
Query  124  YDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKF 183
            YDVSLVDGFN+P+++ P      C   +C A++N VCPSEL K+  DG    C SAC  F
Sbjct  118  YDVSLVDGFNIPLAINPTNAQ--CTAPACKADINAVCPSEL-KV--DG---GCNSACNVF 169
Query  184  GEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242
               QYCC       + CP TNYS+IF  QCP AYSYA DD    F C+ G +Y I FCP
Sbjct  170  KTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDDT-ATFACASGTDYSIVFCP 225

Sequence Alignment: 10. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 68.3 bits 307,  Expect = 2e-13
 Identities = 106/214 49%, Positives = 132/214 61%, Gaps = 25/214 11%
Query  5    LVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTP 64
            LVA  ++SL +   G   A     KN C YTVW A      L   G  L    ++ ++  
Sbjct  11   LVATSAISLHMQEAG---AVKFDIKNQCRYTVWAAG-----LPGGGKRLDQGQTWTVNLA 62
Query  65   V-PWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDF 123
                S RFW RT C+ DASGK  C + DC  GQL C   +G  PATLAE+T +    QD+
Sbjct  63   AGTASARFWGRTGCTFDASGKGSCRSGDC-GGQLSCT-VSGAVPATLAEYTQS---DQDY 117
Query  124  YDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKF 183
            YDVSLVDGFN+P+++ P      C   +C A++N VCPSEL K+  DG    C SAC  +
Sbjct  118  YDVSLVDGFNIPLAINPTNTK--CTAPACKADINAVCPSEL-KV--DG---GCNSACNVL 169
Query  184  GEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242
               QYCC       + CP TNYS+IF  QCP AYSYA DD    F C+ G +Y I FCP
Sbjct  170  QTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDDT-ATFACASGTDYSIVFCP 225

Sequence Alignment: 11. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 68.3 bits 307,  Expect = 2e-13
 Identities = 106/214 49%, Positives = 133/214 62%, Gaps = 25/214 11%
Query  5    LVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTP 64
            LVA L++SL +   G   A     KN C YTVW A      L   G  L    ++ ++  
Sbjct  11   LVATLAISLHMQEAG---AVKFDIKNQCGYTVWAAG-----LPGGGKRLDQGQTWTVNLA 62
Query  65   V-PWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDF 123
                S RFW RT C+ DASGK  C + DC  GQL C   +G  PATLAE+T +    +D+
Sbjct  63   AGTASARFWGRTGCTFDASGKGSCRSGDC-GGQLSCT-VSGAVPATLAEYTQS---DKDY 117
Query  124  YDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKF 183
            YDVSLVDGFN+P+++ P      C   +C A++N VCPSEL K+  DG    C SAC  +
Sbjct  118  YDVSLVDGFNIPLAINPTNTK--CTAPACKADINAVCPSEL-KV--DG---GCNSACNVL 169
Query  184  GEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242
               QYCC       + CP TNYS+IF  QCP AYSYA DD    F C+ G +Y I FCP
Sbjct  170  QTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDDT-ATFACASGTDYSIVFCP 225

Sequence Alignment: 12. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 67.9 bits 305,  Expect = 3e-13
 Identities = 100/193 51%, Positives = 122/193 63%, Gaps = 22/193 11%
Query  29   KNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPV-PWSGRFWARTRCSTDASGKFVC 87
            KN C YTVW A  G P     G E+    ++ ++      S RFW RT C+ DASGK  C
Sbjct  6    KNQCGYTVWAA--GLP---GGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSC 60
Query  88   ETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFNLPMSVTPQGGTGTC 147
             + DC  GQL C   +G  PATLAE+T      QD+YDVSLVDGFN+P+++ P      C
Sbjct  61   RSGDC-GGQLSCT-VSGAVPATLAEYT---QSDQDYYDVSLVDGFNIPLAINPTNTK--C 113
Query  148  KMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTPPQETKEKCPPTNYSQ 207
               +C A++N VCPSEL K+  DG    C SAC  +   QYCC         CP TNYS+
Sbjct  114  TAPACKADINAVCPSEL-KV--DG---GCNSACNVLQTDQYCCR--NAYVNNCPATNYSK 165
Query  208  IFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242
            IF  QCP AYSYA DD    F C+ G +Y I FCP
Sbjct  166  IFKNQCPQAYSYAKDDT-ATFACASGTDYSIVFCP 199

Sequence Alignment: 13. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 57.6 bits 251,  Expect = 4e-10
 Identities = 93/199 46%, Positives = 115/199 57%, Gaps = 21/199 10%
Query  24   ATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWSG-RFWARTRCSTDAS 82
            AT    N C YTVW A+     +   G +L    S+ ++     +G R W RT CS D S
Sbjct  1    ATFEIVNRCSYTVWAAA-----VPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGS 55
Query  83   GKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFNLPMSVTPQG 142
            G+  C+T DC  G L C    G PP TLAEF +      DF+D+SLVDGFN+PM  +P  
Sbjct  56   GRGRCQTGDC-GGVLSCTAY-GNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT- 112
Query  143  GTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTPPQETKEKCPP 202
             +G C+   CAA++N  CP  L+  G       C + C  F   QYCC         C P
Sbjct  113  -SGGCRGIRCAADINGQCPGALKAPGG------CNNPCTVFKTDQYCCNSGA-----CSP 160
Query  203  TNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242
            T+YSQ F   CPDAYSY  DD    FTC GG NY + FCP
Sbjct  161  TDYSQFFKRNCPDAYSYPKDDQTTTFTCPGGTNYRVVFCP 200

Sequence Alignment: 14. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 56.1 bits 243,  Expect = 1e-09
 Identities = 99/221 44%, Positives = 124/221 56%, Gaps = 20/221 9%
Query  3    KTLVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLD 62
            K L  ++SL   +  F   HAAT    N C YTVW A+  +P     G  L    S+ ++
Sbjct  5    KNLPLLVSL-WAITFFAYTHAATFDIVNQCTYTVWAAA--SP---GGGRRLDQGQSWNIN 58
Query  63   T-PVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQ 121
              P     R W RT C+ DA+G+  CET DC+ G L C G  G PP TLAEF +      
Sbjct  59   VAPGTTQARIWGRTNCNFDANGRGQCETGDCN-GLLECQGY-GRPPNTLAEFALNQPNNL 116
Query  122  DFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACV 181
            DF D+S VDGFN+P+  +P   T  C+   C A +   CPSEL+  G       C + C 
Sbjct  117  DFVDISNVDGFNIPLEFSPT--TNVCRRLVCNAPIVQQCPSELRTPG------GCNNPCT 168
Query  182  KFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFC 241
             F   +YCCT        C PT  S+ F E+CPDAYSY  DD   LFTC  G NY + FC
Sbjct  169  VFNTNEYCCT---NGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFC 225
Query  242  P 242
            P
Sbjct  226  P 226

Sequence Alignment: 15. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 55.1 bits 238,  Expect = 2e-09
 Identities = 97/211 45%, Positives = 124/211 58%, Gaps = 20/211 9%
Query  15   LLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS-GRFWA 73
            LL     +AAT+  +NNCPYTVW AS   P     G  L    ++ ++ P      R W 
Sbjct  13   LLCVTYTYAATIEVRNNCPYTVWAAS--TPIGG--GRRLNRGQTWVINAPRGTKMARIWG 68
Query  74   RTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFN 133
            RT C+ +A+G+  C+T DC  G L C G  G PP TLAE+ +      DF+D+SLVDGFN
Sbjct  69   RTGCNFNAAGRGTCQTGDC-GGVLQCTGW-GKPPNTLAEYALDQFSNLDFWDISLVDGFN 126
Query  134  LPMSVTP-QGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTP 192
            +PM+  P +   G C    C AN+N  CP  L+  G       C + C  FG  QYCCT 
Sbjct  127  IPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGG------CNNPCTTFGGQQYCCT- 179
Query  193  PQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGP-NYLITFCP 242
                +  C PT  S+ F ++CPDAYSY  DD    FTC GG  NY + FCP
Sbjct  180  ----QGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226

Sequence Alignment: 16. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 53.0 bits 227,  Expect = 1e-08
 Identities = 94/214 43%, Positives = 125/214 58%, Gaps = 25/214 11%
Query  9    LSLSLTLLS---FGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPV 65
            LSLS  L+    F  A  AT +  NNCP+TVW A+     +   G  L    ++ ++   
Sbjct  7    LSLSALLFIAFLFTCARGATFNIINNCPFTVWAAA-----VPGGGKRLDRGQNWIINPGA 61
Query  66   PWSG-RFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFY 124
               G R W RT C+ D +G+  C+T DC+ G L C    G PP TLAE+ +      DF+
Sbjct  62   GTKGARVWPRTGCNFDGAGRGKCQTGDCN-GLLQCQA-FGQPPNTLAEYALNQFNNLDFF 119
Query  125  DVSLVDGFNLPMSVTPQGGTGTCKMG-SCAANVNLVCPSELQKIGSDGSVVACLSACVKF 183
            D+SLVDGFN+ M  +P   +G C  G  C A++N  CP+EL+  G       C + C  F
Sbjct  120  DISLVDGFNVAMEFSPT--SGGCTRGIKCTADINGQCPNELRAPGG------CNNPCTVF 171
Query  184  GEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242
               QYCC         C  TN+S+ F ++CPDAYSY  DD    FTC  G NY + FCP
Sbjct  172  KTDQYCCN-----SGNCGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 225

Sequence Alignment: 17. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 49.4 bits 208,  Expect = 5e-08
 Identities = 41/87 47%, Positives = 49/87 56%, Gaps = 8/87 9%
Query  21   AHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPV-PWSGRFWARTRCST 79
            A A     KN C YTVW A  G P     G  L    ++ ++      S RFW RT C+ 
Sbjct  4    AGAVKFDIKNQCGYTVWAA--GLPG---GGKRLDQGQTWTVNLAAGTASARFWGRTGCTF 58
Query  80   DASGKFVCETADCDSGQLMCNGKTGIPPATLAEFT 114
            DASGK  C+T DC   QL C   +G  PATLAE+T
Sbjct  59   DASGKGSCQTGDCGR-QLSCT-VSGAVPATLAEYT 91

Sequence Alignment: 18. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 49.4 bits 208,  Expect = 5e-08
 Identities = 41/87 47%, Positives = 49/87 56%, Gaps = 8/87 9%
Query  21   AHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPV-PWSGRFWARTRCST 79
            A A     KN C YTVW A  G P     G  L    ++ ++      S RFW RT C+ 
Sbjct  4    AGAVKFDIKNQCGYTVWAA--GLPG---GGKRLDQGQTWTVNLAAGTASARFWGRTGCTF 58
Query  80   DASGKFVCETADCDSGQLMCNGKTGIPPATLAEFT 114
            DASGK  C+T DC   QL C   +G  PATLAE+T
Sbjct  59   DASGKGSCQTGDCGR-QLSCT-VSGAVPATLAEYT 91

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.