The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAI
VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI
NYWLAHKALCSEKLDQWLCEKL
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA29664 Bos d 4 142 991 282.7 2.6e-78
P00711 Bos d 4 142 986 281.3 6.7e-78
Q28049 Bos d 4 123 876 250.7 9.4e-69
XP_014705584 Equ a 6.01 148 384 113.6 2.2e-27
P11376 Equ c 6.01 129 359 106.7 2.3e-25
P00698 Gal d 4 147 335 99.9 2.9e-23
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bos d 4 Sequence ID: CAA29664

 Score = 282.7 bits 991,  Expect = 3e-78
 Identities = 142/142 100%, Positives = 142/142 100%, Gaps = 0/142 0%
Query  1    MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAI 60
            MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAI
Sbjct  1    MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAI 60
Query  61   VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI 120
            VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI
Sbjct  61   VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI 120
Query  121  NYWLAHKALCSEKLDQWLCEKL 142
            NYWLAHKALCSEKLDQWLCEKL
Sbjct  121  NYWLAHKALCSEKLDQWLCEKL 142

Sequence Alignment: 2. Allergen Name: Bos d 4 Sequence ID: P00711

 Score = 281.3 bits 986,  Expect = 7e-78
 Identities = 141/142 99%, Positives = 141/142 99%, Gaps = 0/142 0%
Query  1    MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAI 60
            MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCT FHTSGYDTQAI
Sbjct  1    MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAI 60
Query  61   VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI 120
            VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI
Sbjct  61   VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI 120
Query  121  NYWLAHKALCSEKLDQWLCEKL 142
            NYWLAHKALCSEKLDQWLCEKL
Sbjct  121  NYWLAHKALCSEKLDQWLCEKL 142

Sequence Alignment: 3. Allergen Name: Bos d 4 Sequence ID: Q28049

 Score = 250.7 bits 876,  Expect = 9e-69
 Identities = 123/123 100%, Positives = 123/123 100%, Gaps = 0/123 0%
Query  20   EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 79
            EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW
Sbjct  1    EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 60
Query  80   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 139
            CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC
Sbjct  61   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 120
Query  140  EKL 142
            EKL
Sbjct  121  EKL 123

Sequence Alignment: 4. Allergen Name: Equ a 6.01 Sequence ID: XP_014705584

 Score = 113.6 bits 384,  Expect = 2e-27
 Identities = 61/137 44%, Positives = 95/137 69%, Gaps = 7/137 5%
Query  1    MMSFVSLLLVGILFHATQAEQLTKCEVFRELK--DLKGYGGVSLPEWVCTAFHTSGYDTQ 58
            M S + + L+  +F   +A+ ++KCE+  +LK  ++ G+GG SL  WVC A + S ++T+
Sbjct  1    MRSTLIISLLSCFFAVYEAKVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTR 60
Query  59   AIV-QN-NDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKIL- 115
            A   +N N S++YGLFQ+NNK WCKD++   SSN CNI C K+LDD++ DDI C K+++ 
Sbjct  61   AFNGKNANGSSDYGLFQLNNKWWCKDNKRS-SSNACNIMCSKLLDDNIDDDISCAKRVVR 119
Query  116  DKVGINYWLAHKALCSEK-LDQWL 138
            D  G++ W A    C +K L ++L
Sbjct  120  DPKGMSAWKAWVKHCKDKDLSEYL 143

Sequence Alignment: 5. Allergen Name: Equ c 6.01 Sequence ID: P11376

 Score = 106.7 bits 359,  Expect = 2e-25
 Identities = 55/116 47%, Positives = 84/116 72%, Gaps = 7/116 6%
Query  22   LTKCEVFRELK--DLKGYGGVSLPEWVCTAFHTSGYDTQAIV-QN-NDSTEYGLFQINNK 77
            ++KCE+  +LK  ++ G+GG SL  WVC A + S ++T+A   +N N S++YGLFQ+NNK
Sbjct  3    FSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSSDYGLFQLNNK 62
Query  78   IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKIL-DKVGINYWLAHKALCSEK-LD 135
             WCKD++   SSN CNI C K+LD+++ DDI C K+++ D  G++ W A    C +K L 
Sbjct  63   WWCKDNKRS-SSNACNIMCSKLLDENIDDDISCAKRVVRDPKGMSAWKAWVKHCKDKDLS 121
Query  136  QWL 138
            ++L
Sbjct  122  EYL 124

Sequence Alignment: 6. Allergen Name: Gal d 4 Sequence ID: P00698

 Score = 99.9 bits 335,  Expect = 3e-23
 Identities = 54/133 40%, Positives = 81/133 60%, Gaps = 7/133 5%
Query  6    SLLLVGILFH--ATQAEQLTKCEVFRELK--DLKGYGGVSLPEWVCTAFHTSGYDTQAIV 61
            SLL++ + F   A   + + +CE+   +K   L  Y G SL  WVC A   S ++TQA  
Sbjct  3    SLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATN 62
Query  62   QNND-STEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKIL-DKVG 119
            +N D ST+YG++QIN++ WC D + P S N+CNI C  +L  D+T  + C KKI+ D  G
Sbjct  63   RNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNG 122
Query  120  INYWLAHKALCS-EKLDQWL 138
            +N W+A +  C    +  W+
Sbjct  123  MNAWVAWRNRCKGTDVQAWI 142

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.