The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG
IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK
KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS
GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV
GSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKR
DTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIKL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAS67041 Pol d 1.0101 337 2292 528.9 1.1e-151
AAS67042 Pol d 1.0102 316 2139 494.1 3.2e-141
AAS67043 Pol d 1.0103 316 2134 492.9 7.2e-141
AAS67044 Pol d 1.0104 316 2117 489.0 1.1e-139
Q9U6W0 Pol a 1 301 1761 407.9 2.7e-115
ABN13879 Poly p 1.0101 322 1696 393.1 8.3e-111
3989146 Pol e 1.0101 302 1426 331.6 2.6e-92
P49369 Ves v 1 336 1213 283.0 1.2e-77
P53357 Dol m 1.02 303 1204 280.9 4.4e-77
C0HLL3 Vesp v 1.0101 304 1167 272.5 1.5e-74
Q06478 Dol m 1.0101 317 1123 262.5 1.7e-71
P51528 Ves m 1 300 1104 258.2 3.2e-70
ACA00159 Vesp c 1.0101 301 1100 257.2 6e-70
3989146 Ves s 1.0101 298 1052 246.3 1.2e-66
AAT95008 Sol i 1.0101 346 499 120.2 1.2e-28
P83542 Pol g 1.0101 42 269 72.7 3e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 528.9 bits 2292,  Expect = 1e-151
 Identities = 337/337 100%, Positives = 337/337 100%, Gaps = 0/337 0%
Query  1    MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG 60
            MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG
Sbjct  1    MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG 60
Query  61   IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK 120
            IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK
Sbjct  61   IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK 120
Query  121  KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS 180
            KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS
Sbjct  121  KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS 180
Query  181  GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV 240
            GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV
Sbjct  181  GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV 240
Query  241  GSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKR 300
            GSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKR
Sbjct  241  GSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKR 300
Query  301  DTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIKL 337
            DTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIKL
Sbjct  301  DTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIKL 337

Sequence Alignment: 2. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 494.1 bits 2139,  Expect = 3e-141
 Identities = 315/316 99%, Positives = 316/316 100%, Gaps = 0/316 0%
Query  22   ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 81
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
Query  82   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 141
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
Query  142  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 201
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
Query  202  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 261
            DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  181  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
Query  262  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 321
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
Query  322  PVDKDAPYCHNEGIKL 337
            PV+KDAPYCHNEGIKL
Sbjct  301  PVEKDAPYCHNEGIKL 316

Sequence Alignment: 3. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 492.9 bits 2134,  Expect = 7e-141
 Identities = 314/316 99%, Positives = 316/316 100%, Gaps = 0/316 0%
Query  22   ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 81
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
Query  82   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 141
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
Query  142  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 201
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
Query  202  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 261
            DPAGPSFLT+KCP+RLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  181  DPAGPSFLTSKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
Query  262  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 321
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
Query  322  PVDKDAPYCHNEGIKL 337
            PVDKDAPYCHNEGIKL
Sbjct  301  PVDKDAPYCHNEGIKL 316

Sequence Alignment: 4. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 489.0 bits 2117,  Expect = 1e-139
 Identities = 312/316 98%, Positives = 315/316 99%, Gaps = 0/316 0%
Query  22   ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 81
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
Query  82   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 141
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
Query  142  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 201
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
Query  202  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 261
            DPAGPSFLT+KCP+RLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  181  DPAGPSFLTSKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
Query  262  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 321
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPK ISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYV 300
Query  322  PVDKDAPYCHNEGIKL 337
            PV+KDAPYCHNEGIKL
Sbjct  301  PVEKDAPYCHNEGIKL 316

Sequence Alignment: 5. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 407.9 bits 1761,  Expect = 3e-115
 Identities = 253/301 84%, Positives = 276/301 91%, Gaps = 0/301 0%
Query  37   ITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNN 96
            ++PDCTFNEKDI ++VYSRDKR+GIILKKE L NYDLF KS IS Q+  LIHGFLSTGNN
Sbjct  1    MSPDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKSTISKQVVFLIHGFLSTGNN 60
Query  97   ENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKL 156
            ENF AM+KALIE D+FLVISVDWKKGACNAFAST D LGYS+AVGNTRHVGK+VADFTKL
Sbjct  61   ENFVAMSKALIEKDDFLVISVDWKKGACNAFASTKDALGYSKAVGNTRHVGKFVADFTKL 120
Query  157  LVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNR 216
            LVE+YKV +SNIRLIGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGP F  + CP+R
Sbjct  121  LVEKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPDR 180
Query  217  LCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECIKR 276
            LC TDAEYVQ IHTS ILGVYYNVGSVDFYVNYGK+QPGC+EPSCSHTKAVKYLTECIK 
Sbjct  181  LCVTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNEPSCSHTKAVKYLTECIKH 240
Query  277  ECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIK 336
            ECCLIGTPWK YFSTPKPISQC+ DTCVCVGLNA+SYPA+G+FY PV+ +APYCHNEGIK
Sbjct  241  ECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGIK 300
Query  337  L 337
            L
Sbjct  301  L 301

Sequence Alignment: 6. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 393.1 bits 1696,  Expect = 8e-111
 Identities = 258/319 80%, Positives = 278/319 87%, Gaps = 21/319 6%
Query  1    MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG 60
            MNFKYSILFICF                  GTLDRG+ P+C FNE DI + VY+R +R+G
Sbjct  1    MNFKYSILFICF------------------GTLDRGLIPECPFNEYDILFFVYTRQQRDG 42
Query  61   IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK 120
            I+L +E L+NYDLF+KS IS Q+  + HGFLS GNNENF AMAKALIE DNFLVISVDWK
Sbjct  43   IVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWK 102
Query  121  KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS 180
            KGACNAFAST D LGYS AVGNTRHVGKYVADFTKLLVEQYKV MSNIRLIGHSLGAHTS
Sbjct  103  KGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTS 162
Query  181  GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV 240
            GFAGKEVQ LKL KY  I GLDPAGPSF +N CP RLCETDAEYVQ IHTS ILGVY  +
Sbjct  163  GFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKI 222
Query  241  GSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQ 297
            G+VDFY+NYG  QPGC     PSCSHTKAVKYLTECIK ECCLIGTPWK YFSTPKPISQ
Sbjct  223  GTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQ 282
Query  298  CKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIKL 337
            C +DTCVCVGLNA+SYPA+GSFYVPV+  APYCHNEGIKL
Sbjct  283  CTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEGIKL 322

Sequence Alignment: 7. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 331.6 bits 1426,  Expect = 3e-92
 Identities = 208/301 69%, Positives = 239/301 79%, Gaps = 2/301 0%
Query  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS-QISHQIAILIHGFLSTG 94
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF KS  +S Q+  LIHGFL++ 
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
Query  95   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 154
                  +++ ALIE D+FLV+SVDWKK            LGYS+       +G YVADFT
Sbjct  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
Query  155  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 214
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGPSFLT+KCP
Sbjct  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
Query  215  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECI 274
            +RLCE+  +Y Q +HTS   GVYYNVGSVDFYVNYGKSQPGC+EPSC   KA KYLTECI
Sbjct  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
Query  275  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
            K ECCLI TPW  YFSTPKPISQC RDTCVCVGLNA+SYPA+G+FY PV+ +APYCHNEG
Sbjct  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
Query  335  IKL 337
            IKL
Sbjct  300  IKL 302

Sequence Alignment: 8. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 283.0 bits 1213,  Expect = 1e-77
 Identities = 178/326 54%, Positives = 233/326 71%, Gaps = 11/326 3%
Query  1    MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG 60
            MN+KY +LF+ FV+VL+ CY   D  +     LDRG  P C FN   + + + +R+ RN 
Sbjct  5    MNLKYLLLFVYFVQVLNCCYGHGDPLSYE---LDRG--PKCPFNSDTVSIIIETRENRNR 59
Query  61   IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK 120
             +   + L+N+  F+K  I+  +  + HGF S+ +  NF  +AKAL++ DN++VIS+DW+
Sbjct  60   DLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASETNFINLAKALVDKDNYMVISIDWQ 119
Query  121  KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS 180
              AC   A+    L Y  A  NTR VG+Y+A  T+ LV++YK+ M+NIRLIGHSLGAH S
Sbjct  120  TAACTNEAAGLKYLYYPTAARNTRLVGQYIATITQKLVKHYKISMANIRLIGHSLGAHAS 179
Query  181  GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV 240
            GFAGK+VQ LKLGKY EIIGLDPA PSF +N C  RLCETDAEYVQ IHTS  LG    +
Sbjct  180  GFAGKKVQELKLGKYSEIIGLDPARPSFDSNHCSERLCETDAEYVQIIHTSNYLGTEKTL 239
Query  241  GSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQ 297
            G+VDFY+N GK+QPGC       CSH++AV Y+ ECIK ECCLIG P KS   + +PIS 
Sbjct  240  GTVDFYMNNGKNQPGCGRFFSEVCSHSRAVIYMAECIKHECCLIGIP-KS--KSSQPISS 296
Query  298  CKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
            C +  CVCVGLNA+ YP++GSFYVPV+  AP+C+N+G
Sbjct  297  CTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 333

Sequence Alignment: 9. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 280.9 bits 1204,  Expect = 4e-77
 Identities = 169/295 57%, Positives = 227/295 76%, Gaps = 9/295 3%
Query  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQIS-HQIAILIHGFLSTG 94
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +F+ S +S  ++  LIHGF+S+ 
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
Query  95   NNENFDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADF 153
             N+N+  M +AL++ D+ +VIS+DW+ GAC N FA     +GY +AV NTR VGKY+ADF
Sbjct  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADF 119
Query  154  TKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKC 213
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE QR+KLGKY EIIGLDPAGPSF    C
Sbjct  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
Query  214  PNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYL 270
            P R+CETDA YVQ +HTS+ LG    +G+VDFY+N G +QPGC+     +CSHT+AVKYL
Sbjct  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
Query  271  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYC 330
            TECI+RECCLIG P       P+P+S+C R+ CVCVGLNA+ YP KGSFYVPV+  AP+C
Sbjct  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
Query  331  HNEG 334
            +N G
Sbjct  297  NNNG 300

Sequence Alignment: 10. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 272.5 bits 1167,  Expect = 2e-74
 Identities = 166/299 55%, Positives = 221/299 73%, Gaps = 8/299 2%
Query  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH-QIAILIHGFLSTG 94
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ KS +S  Q+  LIHGF+S+ 
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
Query  95   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 154
            NN N+  M KAL+E ++ +VIS+DW+ GAC         +GY +AV NTR VGKY+ADF+
Sbjct  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
Query  155  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 214
            KLL+++YKV ++NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F +N C 
Sbjct  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
Query  215  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEP----SCSHTKAVKYL 270
             R+CETDA YVQ IHTS  LG    +G+VDFY+N G +QPGC       +CSHT+AV+Y+
Sbjct  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
Query  271  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYC 330
            TECI+ ECCLIG P       P+P+S+C R+ CVCVGLNA+ YP  GSFYVPV+  APYC
Sbjct  241  TECIRHECCLIGVPQS---KNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
Query  331  HNEGIKL 337
            +N+G K+
Sbjct  298  NNKGKKI 304

Sequence Alignment: 11. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 262.5 bits 1123,  Expect = 2e-71
 Identities = 157/291 53%, Positives = 204/291 70%, Gaps = 6/291 2%
Query  41   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFD 100
            C F+   +++   +R+ R       + +  ++ F+KS I   +  + HGF S+   +NF 
Sbjct  21   CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKSIIKRPVVFITHGFTSSATEKNFV 80
Query  101  AMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQ 160
            AM++AL+   +FL+I VDW+  AC         + Y  AVGNTR VG ++A   K LVEQ
Sbjct  81   AMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAMIAKKLVEQ 140
Query  161  YKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCET 220
            YKVPM+NIRL+GHSLGAH SGFAGK VQ LKLGK+ EIIGLDPAGPSF  N C  R+CET
Sbjct  141  YKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKNDCSERICET 200
Query  221  DAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIKRE 277
            DA YVQ +HTS+ LG    +G+VDFY+N G +QPGC      +CSHT+AVKY+TECI+RE
Sbjct  201  DAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRYIIGETCSHTRAVKYFTECIRRE 260
Query  278  CCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
            CCLIG P       P+P+S+C R+ CVCVGLNA+ YP +GSFYVPV+ +APYC+N G
Sbjct  261  CCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPYCNNNG 314

Sequence Alignment: 12. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 258.2 bits 1104,  Expect = 3e-70
 Identities = 158/293 53%, Positives = 206/293 70%, Gaps = 6/293 2%
Query  39   PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNEN 98
            P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S+ + +N
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
Query  99   FDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLV 158
            F  +AKAL++ DN++VIS+DW+  AC           Y  A  NTR VG+Y+A  T+ LV
Sbjct  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLV 121
Query  159  EQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLC 218
            + YK+ M+NIRLIGHSLGAH SGFAGK VQ LKLGKY EIIGLDPA PSF +N C  RLC
Sbjct  122  KDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLC 181
Query  219  ETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIK 275
            ETDAEYVQ IHTS  LG    +G+VDFY+N GK+ PGC       CSHT+AV Y+ ECIK
Sbjct  182  ETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECIK 241
Query  276  RECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
             ECCLIG P +S   + +PIS+C +  CVCVGLNA+ YP++GSFYVPV+  AP+C+N+G
Sbjct  242  HECCLIGIP-RS--KSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297

Sequence Alignment: 13. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 257.2 bits 1100,  Expect = 6e-70
 Identities = 162/290 55%, Positives = 210/290 72%, Gaps = 9/290 3%
Query  41   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILI-HGFLSTGNNENF 99
            C +++  +++ V +R+ +       + +KN++ F K  I+ +  ++I HGF S+   ENF
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEF-KDTITLKPHVFITHGFTSSATAENF 62
Query  100  DAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVE 159
              MAKAL++  N+LVI  DW+  AC    +   +  Y  A  NTR VG Y+A  TK+LV+
Sbjct  63   VVMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQ 122
Query  160  QYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCE 219
            +Y VPM+NIRLIGHSLGAH SGFAGK+VQ L LGKY EIIGLDPAGPSF +N C  R+CE
Sbjct  123  KYNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICE 182
Query  220  TDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEP----SCSHTKAVKYLTECIK 275
            TDA YVQ IHTS  LG    +G+VDFY+N G +QPGC  P    +CSHT+AVKY+TECIK
Sbjct  183  TDANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIK 242
Query  276  RECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
             ECCLIG P KS    P+P+S+C R+ CVCVGLNA++YP  GSFYVPV+  APYC+N+G
Sbjct  243  HECCLIGVP-KS--KNPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKG 298

Sequence Alignment: 14. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 246.3 bits 1052,  Expect = 1e-66
 Identities = 154/288 53%, Positives = 198/288 68%, Gaps = 10/288 3%
Query  41   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFD 100
            C F++  + + + +R+ RN      + L+N+D F+K  I+  +  + HGF S+   E+F 
Sbjct  4    CPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKKAITRPVVFITHGFTSSATVESFV 63
Query  101  AMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQ 160
             +  A++E     V   DW+  ACN    T  +L Y  AV NTR VG+Y+A  TK LV  
Sbjct  64   DLQTAILEXXXXKVTVSDWRVAACN---RTTGLLYYVTAVSNTRLVGRYIATVTKKLVTD 120
Query  161  YKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCET 220
            Y V M++IRLIGHSLGAH SGFAGKEVQ+LKL KY EIIGLDPAGPSF +N C  RLC+T
Sbjct  121  YNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERLCKT 180
Query  221  DAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCS----EPSCSHTKAVKYLTECIKR 276
            DA YVQ IHTS  +G+  ++G VDFYVN G +QPGC     +  CSH++A+ Y+TECIKR
Sbjct  181  DAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTECIKR 240
Query  277  ECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
            ECCLIG P      + K IS C R  CVCVGL A+SYP  GSFYVPV+  AP+C+N+G
Sbjct  241  ECCLIGIPQSK---SSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKG 295

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 120.2 bits 499,  Expect = 1e-28
 Identities = 95/308 30%, Positives = 158/308 51%, Gaps = 24/308 7%
Query  4    KYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIIL 63
            K++ +F+ F     + Y+        +  +   +   C +      ++VY  + R    +
Sbjct  3    KFAAIFVVFFVQCTHLYSLAQARAEPDPGVVEYLKQSCVYGNSSY-INVYLYNSR----F 57
Query  64   KKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGA 123
            + + L N    Q    S  +  + HGF S+     F  +A A+++  +   I VDW + A
Sbjct  58   QGKNLGNQQSCQDINASLPVVFITHGFTSSAQVSTFKDLANAFVQKGHTAFI-VDWSEAA 116
Query  124  CNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFA 183
            C           Y+ A  NT  +G+ +A +T  L+ + K+P++NI+ +GHSLG+H  GFA
Sbjct  117  CTDGLPGVQFAEYNAAASNTYDIGQLMAKYTVDLMNKCKIPLNNIQYVGHSLGSHVCGFA 176
Query  184  GKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV-GS 242
             K V++L       I+ LDPA PSF +NKC  R+C++DA+ +    TS ILG+  N+ G 
Sbjct  177  AKHVKKLINKTMPYILALDPADPSFGSNKCGERICKSDAKRIVVFKTS-ILGIGENIIGH 235
Query  243  VDFYVNYGKSQPGCS--EPSCSHTKAVKYLTECIKRECCLIGTPWKSY------------ 288
            +    + GKSQP CS  +  CSH++++ Y T  +   C  +  PW +             
Sbjct  236  LLIVFDGGKSQPACSWYDVPCSHSESIVYATGMVSGRCQHLAVPWTAQQRINPIQWKFWR 295
Query  289  -FSTPKPISQCKRDTCVCVGLNAQSYPAKGSF 319
             F++  P      DT  CV LN   +    +F
Sbjct  296  VFTSNIPAYPTS-DTTNCVVLNTNVFKNDNTF 326

Sequence Alignment: 16. Allergen Name: Pol g 1.0101 Sequence ID: P83542

 Score = 72.7 bits 269,  Expect = 3e-15
 Identities = 40/42 95%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS 77
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLF++S
Sbjct  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.