The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ
KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ
ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES
LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE
QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE
VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR
IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE
IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK
TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ
AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE
LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD
VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK39511 Der f 11.0101 692 4234 971.2 0
AAO73464 Der p 11 875 4156 953.4 0
AAM83103 Blo t 11 875 3907 896.7 0
AAF72796 Ani s 2 869 2231 514.6 1.2e-146
QPB41107 Rap v 2.0101 859 1459 338.7 1.1e-93
D3XNR9 Mac r 1.0101 284 252 63.8 1.9e-11
CBY17558 Pan b 1.0101 284 249 63.2 3.1e-11
11893851 Pen a 1 284 247 62.7 4.3e-11
EU410072 Lit v 1.0101 284 247 62.7 4.3e-11
AAX37288 Pen m 1 284 247 62.7 4.3e-11
BAA04557 Der f 10.0101 299 246 62.4 5.4e-11
Q25456 Met e 1 274 243 61.8 7.7e-11
AAC48288 Hom a 1.0102 284 236 60.2 2.4e-10
Q9N2R3 Cha f 1 264 235 60.0 2.6e-10
ABU97466 Blo t 10.0101 284 235 60.0 2.9e-10
O18416 Der p 10 284 233 59.5 3.9e-10
M4M2H6 Mel l 1.0101 284 232 59.3 4.6e-10
Q9NFZ4 Lep d 10 284 232 59.3 4.6e-10
C0LU07 Pro c 1.0101 284 231 59.0 5.4e-10
O44119 Hom a 1.0101 284 231 59.0 5.4e-10
NP_001103782 Bomb m 3.0101 285 229 58.6 7.4e-10
Q9UB83 Per a 7 284 223 57.2 1.9e-09
AAG08989 Mim n 1 284 222 57.0 2.2e-09
AEX31649 Cho a 10.0101 284 221 56.8 2.6e-09
AAD19606 Per a 7.0102 284 217 55.9 4.9e-09
AAF72534 Bla g 7.0101 284 211 54.5 1.3e-08
M1H607 Por p 1.0101 284 210 54.3 1.5e-08
AVD53650 Sac g 1.0101 284 209 54.0 1.7e-08
XP_026775428 Pan h 4.0201 284 208 53.8 2e-08
Q17H75 Aed a 10.0101 285 208 53.8 2e-08
CAA09938 Chi k 10 285 207 53.6 2.4e-08
XP_026781482 Pan h 4.0101 284 201 52.2 6.1e-08
NP_001117128 Sal s 4.0101 284 200 52.0 7.2e-08
APG42675 Hal l 1.0101 284 200 52.0 7.2e-08
ACN32322 Asc l 3.0101 287 200 52.0 7.3e-08
O61379 Pan s 1 274 197 51.3 1.1e-07
CAC84590 Lep s 1 284 193 50.4 2.2e-07
AAG08987 Hal d 1 284 192 50.2 2.5e-07
Q17H80 Aed a 10.0201 284 191 49.9 3e-07
AAK96889 Cra g 1 233 189 49.6 3.1e-07
AAT40866 Tyr p 10.0101 284 190 49.7 3.5e-07
AAG08988 Per v 1 284 190 49.7 3.5e-07
Q9NAS5 Ani s 3 284 189 49.5 4.1e-07
CAB38044 Hel as 1 284 186 48.8 6.6e-07
AGM32377.1 Copt f 7.0101 256 179 47.3 1.7e-06
P02538 Hom s 5 564 175 46.1 8.7e-06
A7L5V2 Scy p 1.0101 284 162 43.3 2.9e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 971.2 bits 4234,  Expect = 0
 Identities = 692/692 100%, Positives = 692/692 100%, Gaps = 0/692 0%
Query  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
            MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ
Sbjct  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
Query  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
            KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ
Sbjct  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
Query  121  ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES 180
            ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES
Sbjct  121  ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES 180
Query  181  LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 240
            LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE
Sbjct  181  LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 240
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
            QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
            VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
Query  361  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 420
            IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE
Sbjct  361  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 420
Query  421  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 480
            IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK
Sbjct  421  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 480
Query  481  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ 540
            TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ
Sbjct  481  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ 540
Query  541  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 600
            AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE
Sbjct  541  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 600
Query  601  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 660
            LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD
Sbjct  601  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 660
Query  661  VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692
            VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ
Sbjct  661  VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692

Sequence Alignment: 2. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 953.4 bits 4156,  Expect = 0
 Identities = 675/692 97%, Positives = 688/692 99%, Gaps = 0/692 0%
Query  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
            MNKKRDSELAKLRKLLEDVH+ESEETAHHLRQKHQAA++EMQDQLDQLQKAKNKSDKEKQ
Sbjct  87   MNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAVHEMQDQLDQLQKAKNKSDKEKQ 146
Query  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
            KFQAEVFELL+QLETANKEKLTALK+VEKLEYTVHELNIKIEEINRTVIELTSHKQRL+Q
Sbjct  147  KFQAEVFELLSQLETANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSHKQRLTQ 206
Query  121  ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES 180
            ENTELIKEVHEVKLQLDNANHLK QIAQQLEDTRHRLEEEERKR+SLENHAHTLEVELES
Sbjct  207  ENTELIKEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELES 266
Query  181  LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 240
            LKVQLD+ESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE
Sbjct  267  LKVQLDDESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 326
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
            QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKA  HAQQLEKRVAQLEKINLDLK+KLEE
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEE 386
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
            VTMLMEQAQKELR+KI ELQKLQHEYEK+RDQRDQLARENKKLTDDLAEAKSQLNDAHRR
Sbjct  387  VTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 446
Query  361  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 420
            IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE
Sbjct  447  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 506
Query  421  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 480
            IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK
Sbjct  507  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 566
Query  481  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ 540
            TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQA+RAKRQ
Sbjct  567  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQASRAKRQ 626
Query  541  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 600
            AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE
Sbjct  627  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 686
Query  601  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 660
            LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD
Sbjct  687  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 746
Query  661  VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692
            VEIEVEEERRRHAET+KMLRKKDHRVKELLLQ
Sbjct  747  VEIEVEEERRRHAETEKMLRKKDHRVKELLLQ 778

Sequence Alignment: 3. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 896.7 bits 3907,  Expect = 0
 Identities = 629/692 90%, Positives = 665/692 96%, Gaps = 0/692 0%
Query  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
            MNKKRDSELAKLRKLLEDVH+ESEETAHHLRQKHQAAIQEMQDQLDQ+QKAKNKSDKEKQ
Sbjct  87   MNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKSDKEKQ 146
Query  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
            KFQAEVFELLAQ+ETANK+KL A K VEKLEYTVHELNIKIEEINRTV+E+T+H+QRLSQ
Sbjct  147  KFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQ 206
Query  121  ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES 180
            EN+ELIKEVHE K+ LDNANHLK QIAQQLEDTRHRLE+EERKR+SLENHAHTLEVELES
Sbjct  207  ENSELIKEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELES 266
Query  181  LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 240
            LKVQL+EESEARLELERQLTKANGDAASWKSKYEAELQAH DEVEELRRKMAQKISEY E
Sbjct  267  LKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGE 326
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
            QLEALLNKCS+LEKQK+RLQSEVEVLIMDLEKAT HAQ LEKRV+QLEKINLDLK+KLEE
Sbjct  327  QLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEE 386
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
            V+ML+EQ QK+LRVKIA+LQKLQHEYEKLRDQ++ LARENKKL DDLAEAKSQLNDAHRR
Sbjct  387  VSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRR 446
Query  361  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 420
            IHEQEIEIKRLENER+EL+AAYKEAETLRKQEEAKNQRL AELAQ RHDYEKRLAQK+EE
Sbjct  447  IHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEE 506
Query  421  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 480
            IEALRKQYQIEIEQLNMRLAEAEAKLKTE+ARLKKKYQAQITELELSLDAANKANIDLQK
Sbjct  507  IEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSLDAANKANIDLQK 566
Query  481  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ 540
            TIKKQALQIT LQAHYDEVHRQLQQAVDQLGVTQRRCQAL AELEEMR+ LEQA RAKR 
Sbjct  567  TIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNLEQALRAKRA 626
Query  541  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 600
            AEQ+HEEAVVRVNELTTINVNLASAKSKLE+EFSALQ DYDEVHKELRISDERVQKLTIE
Sbjct  627  AEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQNDYDEVHKELRISDERVQKLTIE 686
Query  601  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 660
            +KSTKDLL  E ER+ KLET+KKSLE EVR L++RIEEVEANALAGGKRVIAKLESRIRD
Sbjct  687  VKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGKRVIAKLESRIRD 746
Query  661  VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692
            VEIEVEEERRRHAET+KMLRKKDHRVKELLLQ
Sbjct  747  VEIEVEEERRRHAETEKMLRKKDHRVKELLLQ 778

Sequence Alignment: 4. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 514.6 bits 2231,  Expect = 1e-146
 Identities = 352/691 50%, Positives = 510/691 73%, Gaps = 0/691 0%
Query  2    NKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQK 61
            N+KR+ EL+KLRKLLE+ ++E+E+  + LR+KHQ    +  +Q++QLQK  +K D+E+Q+
Sbjct  90   NRKREVELSKLRKLLEESQLENEDAMNVLRKKHQDVCLDYTEQIEQLQKKNSKIDRERQR 149
Query  62   FQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQE 121
            +Q EV EL A ++   K+K  A K  +K+E    EL+ K+E++N+ V +L  ++QRL  E
Sbjct  150  LQHEVIELTATIDQLQKDKHVAEKMAQKFEQQTIELSNKVEDLNKHVNDLAQQRQRLQAE 209
Query  122  NTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESL 181
            N++L+ E+H+ K+QLDN  H+K Q+AQQLE++R RLE+ ER+R+ ++ + H +++EL+S+
Sbjct  210  NSDLLAEIHDQKVQLDNLQHVKYQLAQQLEESRRRLEDAERERSQMQAQLHQVQLELDSV 269
Query  182  KVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQ 241
            +V LDEES AR+E E +L+ AN +   WKSK++AE+  H +EVE+LR+KM QK +EYEEQ
Sbjct  270  RVALDEESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAEYEEQ 329
Query  242  LEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEV 301
            +E +L K S LEK K+RLQSEVEVLI+DLEKA      LE+   QLEK  L++K++++E+
Sbjct  330  IEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLEKQVLEMKSRIDEL 389
Query  302  TMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRRI 361
             + +E AQ+E R  +AELQK+++ YEK  +Q++ LARENKKL DDL EA   L DA+R++
Sbjct  390  LVELEAAQREARAALAELQKMKQLYEKAVEQKEALARENKKLQDDLHEANEALADANRKL 449
Query  362  HEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEEI 421
            HE ++E  RL  E  +L  A KE+E  R+  EA+ QR +AEL QVR + E+RL +K+EE+
Sbjct  450  HELDLENARLAGEIRDLQVALKESEAARRDAEARAQRALAELQQVRIEMERRLQEKEEEM 509
Query  422  EALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQKT 481
            EALRK  Q EI++L   LA+AEA++K EIARL+KKYQA+I ELE+++D  N+AN++ QKT
Sbjct  510  EALRKSMQFEIDRLTAALADAEARMKAEIARLRKKYQAEIAELEMTVDNLNRANLEAQKT 569
Query  482  IKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQA 541
            IKKQ+ QI +LQA+ ++ +RQLQQ +DQ  + QR+  AL AELEE + AL+ A RA++QA
Sbjct  570  IKKQSEQIIQLQANLEDTQRQLQQTLDQYALAQRKISALSAELEECKTALDNAIRARKQA 629
Query  542  EQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIEL 601
            E   EEA VR+++LT+IN NL + K+KLE+E+S  QAD DEV KEL  +DER  +   + 
Sbjct  630  EADLEEAHVRISDLTSINSNLTAIKNKLETELSTAQADLDEVTKELHAADERANRALADA 689
Query  602  KSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRDV 661
                  L EEQE  +K++ ++KSLE++V+ L+V+I+E EA AL GGKRVIAKLE+RIRD+
Sbjct  690  ARAVQELHEEQEHSMKIDALRKSLEEQVKQLQVQIQEAEAAALLGGKRVIAKLETRIRDL 749
Query  662  EIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692
            E+ ++EE RRH ET   LRKKD R+KE+ +Q
Sbjct  750  EVALDEETRRHKETQSALRKKDRRIKEVQMQ 780

Sequence Alignment: 5. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 338.7 bits 1459,  Expect = 1e-93
 Identities = 262/690 37%, Positives = 416/690 60%, Gaps = 4/690 0%
Query  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
            ++KKR+SE+ KLRK +E    + E T   +R++HQ ++ ++ DQ+D L K KN+ +KEKQ
Sbjct  83   ISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRVEKEKQ 142
Query  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
             +  E+  L  QLE+ +K K T    V+  E +   L  +++++ R + ELTS K RL+Q
Sbjct  143  TLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLKSRLTQ 202
Query  121  ENTELIKEVHEVKLQLDNA--NHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVEL 178
            EN +L  +V+E  L  +NA     ++Q+    +D + +L++E R+R +L+ +   L+ + 
Sbjct  203  ENFDLQHQVQE--LDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNLSALQADY 260
Query  179  ESLKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEY 238
            ++L V+L+EE+E    L  QL+K N D ++ KS+++ EL    +E+E+L+R+M  +I+E 
Sbjct  261  DNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRMQVRITEL 320
Query  239  EEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKL 298
            E+  E L  K SSLEK K++L +E++ + ++LE      Q L KR  QLE  N  L+ ++
Sbjct  321  EDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENENAGLQRRI 380
Query  299  EEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAH 358
            EE+T      + E  +   ++QKL+    +L ++ D L RENK L+D L EA   L DA+
Sbjct  381  EELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDAN 440
Query  359  RRIHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKD 418
            R + +      +LE ERD L+AA K+ E   +  EAK     A L Q++ D E RL +KD
Sbjct  441  RELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKD 500
Query  419  EEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDL 478
            EEIE +R+     IE+L   L E E + KTEI+R+KKK+++ I ELE +LD AN+AN + 
Sbjct  501  EEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEY 560
Query  479  QKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAK 538
             K IK    ++ EL+   +E  R      +QLGV +R+  AL  ELE+ R  LE A RA+
Sbjct  561  LKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERAR 620
Query  539  RQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLT 598
            + AE    +   R++E+T    +L + K +LE+++SA+Q+D D+     R ++ER ++L 
Sbjct  621  KNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAERLA 680
Query  599  IELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRI 658
             E     D L +EQE     E+++K LE E+R + +R+EE EA A   G+R++AKL+ R+
Sbjct  681  AENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLVAKLQVRV 740
Query  659  RDVEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692
            RD+E E+E E RR  E+    RK +   KEL+ Q
Sbjct  741  RDLEAELENEARRVRESVANQRKAERLHKELVAQ 774

Sequence Alignment: 6. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 63.8 bits 252,  Expect = 2e-11
 Identities = 65/256 25%, Positives = 135/256 52%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+S++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSVQEALL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + ++   E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 7. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 63.2 bits 249,  Expect = 3e-11
 Identities = 65/256 25%, Positives = 134/256 52%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++  +R E+ E +   L+   + LE +L+S++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSVQEALL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + ++   E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 8. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 62.7 bits 247,  Expect = 4e-11
 Identities = 64/256 25%, Positives = 134/256 52%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 9. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 62.7 bits 247,  Expect = 4e-11
 Identities = 64/256 25%, Positives = 134/256 52%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 10. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 62.7 bits 247,  Expect = 4e-11
 Identities = 64/256 25%, Positives = 134/256 52%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 11. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 62.4 bits 246,  Expect = 5e-11
 Identities = 65/269 24%, Positives = 139/269 51%, Gaps = 8/269 2%
Query  114  HKQRLSQENTELIKEVHEVKLQLDNANHLKTQIAQQ-LEDTRHRLEEEERKRASLENHAH 172
            ++Q+ S +   + K+++ +KL+ DNA   + +IA+Q   D   R E+ E +  +L+   +
Sbjct  8    QQQQPSTKMEAIKKKMQAMKLEKDNAID-RAEIAEQKARDANLRAEKSEEEVRALQKKIQ 66
Query  173  TLEVELESLKVQLDEESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRR 229
             +E EL+ ++ QL   +    E E+ L  A GD A+   +    E +L+   + ++    
Sbjct  67   QIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATA 126
Query  230  KM---AQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQ 286
            K+   +Q   E E   + L ++  + E++   L+++++   M  E A R   ++ +++A 
Sbjct  127  KLEEASQSADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAM 186
Query  287  LEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDD 346
            +E      + + E     + + ++ELRV    L+ L+   EK + + +   ++ + +T  
Sbjct  187  VEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAK 246
Query  347  LAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYK 383
            L EA+++   A R +++ + E+ RLE+E       YK
Sbjct  247  LKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYK 283

Sequence Alignment: 12. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 61.8 bits 243,  Expect = 8e-11
 Identities = 63/251 25%, Positives = 130/251 51%, Gaps = 8/251 3%
Query  132  VKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEA 191
            +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L + +  
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  192  RLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEEQLEAL 245
             +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E   + L
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  246  LNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLM 305
             N+  S E++   L+++++      E+A R   ++ +++A +E      + + E     +
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  306  EQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHRRIHEQ 364
             + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R +++ 
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
Query  365  EIEIKRLENERDELSAAYK 383
            + E+ RLE+E       YK
Sbjct  240  QKEVDRLEDELVNEKEKYK 258

Sequence Alignment: 13. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 60.2 bits 236,  Expect = 2e-10
 Identities = 63/256 24%, Positives = 131/256 51%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +    E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLANKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 14. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 60.0 bits 235,  Expect = 3e-10
 Identities = 62/247 25%, Positives = 126/247 51%, Gaps = 8/247 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++   R E+ E +  + +   + +E EL+  + QL 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
              +    E E+ L  A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   AANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAES 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREETYKEQIKTLANKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENE 374
             +++ + E+ RLE+E
Sbjct  245  SVQKLQKEVDRLEDE 259

Sequence Alignment: 15. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 60.0 bits 235,  Expect = 3e-10
 Identities = 62/256 24%, Positives = 132/256 51%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQL-EDTRHRLEEEERKRASLENHAHTLEVELESLKVQL 185
            K+++ +KL+ DNA   + +IA+Q   D   R E+ E +  +L+   + +E EL+ ++  L
Sbjct  6    KKMQAMKLEKDNAID-RAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQVQESL 64
Query  186  DEESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM--AQKISEYEE 240
             + +    E E+ L  A GD A+   +    E +L+   + ++    K+  A   ++  E
Sbjct  65   TQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESE 124
Query  241  QLEALLNKCSSLEKQK-SRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE 299
            ++  +L   S  ++++   L+S+++   M  E A R   ++ +++A +E      + + E
Sbjct  125  RMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAE 184
Query  300  EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHR 359
                 + + ++ELRV    L+ L+   EK + + +   ++ + +T  L EA+++   A R
Sbjct  185  TGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             + + + E+ RLE+E       YK
Sbjct  245  SVRKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 16. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 59.5 bits 233,  Expect = 4e-10
 Identities = 65/259 25%, Positives = 134/259 51%, Gaps = 9/259 3%
Query  124  ELIK-EVHEVKLQLDNANHLKTQIAQQ-LEDTRHRLEEEERKRASLENHAHTLEVELESL 181
            E IK +++ +KL+ DNA   + +IA+Q   D   R E+ E +  +L+   + +E EL+ +
Sbjct  2    EAIKNKMQAMKLEKDNAID-RAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  182  KVQLDEESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM---AQKI 235
            + QL   +    E E+ L  A GD A+   +    E +L+   + ++    K+   +Q  
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  236  SEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLK 295
             E E   + L ++  + E++   L+++++   M  E A R   ++ +++A +E      +
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  296  NKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLN 355
             + E     + + ++ELRV    L+ L+   EK + + +   ++ + +T  L EA+++  
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  356  DAHRRIHEQEIEIKRLENERDELSAAYK 383
             A R +++ + E+ RLE+E       YK
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYK 268

Sequence Alignment: 17. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 59.3 bits 232,  Expect = 5e-10
 Identities = 63/256 24%, Positives = 130/256 50%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++   R E+ E     L+   + LE +++ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
              +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   LANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 18. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 59.3 bits 232,  Expect = 5e-10
 Identities = 65/259 25%, Positives = 132/259 50%, Gaps = 9/259 3%
Query  124  ELIK-EVHEVKLQLDNANHLKTQIAQQL-EDTRHRLEEEERKRASLENHAHTLEVELESL 181
            E IK +++ +KL+ DNA   + +IA+Q   D   R E+ E +   L+   + +E EL+ +
Sbjct  2    EAIKNKMQAMKLEKDNAID-RAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  182  KVQLDEESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM---AQKI 235
            +  L + +    E E+ L  A GD A+   +    E +L+     ++    K+   +Q  
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  236  SEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLK 295
             E E   + L ++  + E++   L+S+++   M  E A R   ++ +++A +E      +
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  296  NKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLN 355
             + E     + + ++ELRV    L+ L+   EK + + +   ++ + +T  L EA+++  
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  356  DAHRRIHEQEIEIKRLENERDELSAAYK 383
             A R +++ + E+ RLE+E       YK
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 19. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 59.0 bits 231,  Expect = 5e-10
 Identities = 62/256 24%, Positives = 130/256 50%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++  KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQVQESLL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +    E ++ ++ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLANKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 20. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 59.0 bits 231,  Expect = 5e-10
 Identities = 64/256 25%, Positives = 127/256 49%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++   R E+ E +        + +E EL+ ++ QL 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQVQEQLS 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
              +    E E+ L  A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   LANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLANKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 21. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 58.6 bits 229,  Expect = 7e-10
 Identities = 61/258 23%, Positives = 126/258 48%, Gaps = 6/258 2%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA        QQ +D   R E+ E +   L+   +T+E EL+  +  L 
Sbjct  6    KKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLM 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +    E E+ L  A  + A+   +    E +L+   + +     K++   Q   E E 
Sbjct  66   QVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  + E++   L+++++      E+A +   ++ +++A +E      + + E 
Sbjct  126  ARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAES 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
                + + ++ELRV    L+ L+   EK   + ++   + K LT  L EA+++   A R 
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERS 245
Query  361  IHEQEIEIKRLENERDELSAAYKE 384
            +++ + E+ RLE+E       YK+
Sbjct  246  VQKLQKEVDRLEDELVAEKEKYKD 269

Sequence Alignment: 22. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 57.2 bits 223,  Expect = 2e-09
 Identities = 63/256 24%, Positives = 128/256 50%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA        QQ  D   R E+ E +  SL+   + +E +L+    QL 
Sbjct  6    KKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQL- 64
Query  187  EESEARL-ELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYE 239
             +  A+L E ++ L  A  + A+   +    E +L+   + +     K+A   Q + E E
Sbjct  65   MQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAVDESE 124
Query  240  EQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE 299
               + L +K  + E++   L+++++      E+A +   ++ +++A +E      + + E
Sbjct  125  RARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAE 184
Query  300  EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHR 359
                 + + ++ELRV    L+ L+   EK   + ++  ++ K LT  L EA+++   A R
Sbjct  185  SGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 23. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 57.0 bits 222,  Expect = 2e-09
 Identities = 63/239 26%, Positives = 134/239 56%, Gaps = 24/239 10%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDT---RHRLEEE----ERKRASLENHAHTLEVELE 179
            K+++ +K+  +NA  L  Q+ Q+L+DT   + +LEEE    ++K  + EN+  T+  +L+
Sbjct  6    KKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQ 65
Query  180  SLKVQLD--EESEARLE-----LERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMA 232
                +L+  E+   +LE     L+R+LT    D      + E +L +  +++EE     +
Sbjct  66   EANTKLENSEKQITQLESDVGGLQRRLTLLEEDYE----RSEEKLNSTTEKLEE----AS 117
Query  233  QKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINL 292
            +   E E   + L  + +S E++   L+ ++E        A     +  +++A  E ++L
Sbjct  118  KAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITE-VDL 176
Query  293  D-LKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAK 351
            +  + +LE     + + ++EL V  A ++ LQ + ++   + D      + LT  L +A+
Sbjct  177  ERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAE 236
Query  352  SQLNDAHRRIHEQEIEIKRLENE 374
            ++  +A R++ + + E+ RLE+E
Sbjct  237  NRATEAERQVVKLQKEVDRLEDE 259

Sequence Alignment: 24. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 56.8 bits 221,  Expect = 3e-09
 Identities = 59/256 23%, Positives = 132/256 51%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQL-EDTRHRLEEEERKRASLENHAHTLEVELESLKVQL 185
            K+++ +KL+ DNA   + +IA+Q   D   + E+ E +   L+   + +E EL+ ++  +
Sbjct  6    KKMQAMKLEKDNAID-RAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESF 64
Query  186  DEESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM--AQKISEYEE 240
             + +    E E+ L  A GD A+   +    E +L+   + ++    K+  A   ++  E
Sbjct  65   TQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESE 124
Query  241  QLEALLNKCSSLEKQK-SRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE 299
            ++  +L   S  ++++   L+++++   M  E A R   ++ +++A +E      + + E
Sbjct  125  RMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAE 184
Query  300  EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHR 359
                 + + ++ELRV    L+ L+   EK + + +   ++ + +T  L EA+++   A R
Sbjct  185  TGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 25. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 55.9 bits 217,  Expect = 5e-09
 Identities = 63/256 24%, Positives = 127/256 49%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA        QQ  D   R E+ E +  SL+   + +E +L+    QL 
Sbjct  6    KKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQL- 64
Query  187  EESEARL-ELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYE 239
             +  A+L E ++ L  A  + A+   +    E +L+   + +     K+A   Q   E E
Sbjct  65   MQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESE 124
Query  240  EQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE 299
               + L +K  + E++   L+++++      E+A +   ++ +++A +E      + + E
Sbjct  125  RARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAE 184
Query  300  EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHR 359
                 + + ++ELRV    L+ L+   EK   + ++  ++ K LT  L EA+++   A R
Sbjct  185  SGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 26. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 54.5 bits 211,  Expect = 1e-08
 Identities = 62/256 24%, Positives = 126/256 49%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA        QQ  D   R E+ E +  SL+   + +E +L+    QL 
Sbjct  6    KKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQTMEQL- 64
Query  187  EESEARL-ELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYE 239
             +  A+L E ++ L  A  + A+   +    E +L+   + +     K+A   Q   E E
Sbjct  65   MQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESE 124
Query  240  EQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE 299
               + L +K  + E++   L+++++      E+A +   ++ +++A +E      + + E
Sbjct  125  RARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAE 184
Query  300  EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHR 359
                 + + ++ELRV    L+ L+   EK   + ++  ++ K L   L EA+++   A R
Sbjct  185  TGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 27. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 54.3 bits 210,  Expect = 1e-08
 Identities = 63/256 24%, Positives = 132/256 51%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ D+A      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
            + +    E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   KANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 28. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 54.0 bits 209,  Expect = 2e-08
 Identities = 67/252 26%, Positives = 142/252 56%, Gaps = 33/252 13%
Query  411  EKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDA 470
            +K +A K E+  A  +  Q+E +QL     E +AK++ ++  L+KK+    + LE  +D 
Sbjct  6    KKMIAMKMEKENAQDRAEQLE-QQLR-DTEEQKAKIEEDLTTLQKKH----SNLENEFDI 59
Query  471  ANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIA 530
             N+   D Q   ++   + +E +     ++R++Q   + +  ++ R Q    +LEE   A
Sbjct  60   VNEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKA 119
Query  531  LEQANRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQAD--YDEVHKELR 588
             +++ R ++  E L+  +  R + L          K   E+++ A +AD  YDE  ++L 
Sbjct  120  ADESERNRKVLENLNNASEERTDVLE---------KQLTEAKLIAEEADKKYDEAARKLA 170
Query  589  ISDERVQKLTIELKSTKDLLIEEQERL------VKLETVKK--------SLEQEVRTLHV 634
            I++  +++    L++ +  +I+ +E+L      +K   V+         S E+ +R L  
Sbjct  171  ITEVDLERAEARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQ 230
Query  635  RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRH-AETDKM 678
            R+++ E  A    +R ++KL+  +  +E E+  E+ R+ A +D++
Sbjct  231  RLKDAENRATEA-ERTVSKLQKEVDRLEDELLAEKERYKAISDEL 274

Sequence Alignment: 29. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 53.8 bits 208,  Expect = 2e-08
 Identities = 78/261 29%, Positives = 143/261 54%, Gaps = 32/261 12%
Query  30   LRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQKFQAEVFELLAQLETANKEKLTALKNVEK 89
            +++K Q    + ++ LD+ ++A+  SDK+  + +++      QLE    + L AL+  +K
Sbjct  4    IKKKMQMLKLDKENALDRAEQAE--SDKKAAEDRSK------QLE----DDLVALQ--KK 49
Query  90   LEYTVHELNIKIEEIN--RTVIELTSHKQRLSQENTE-LIKEVHEVKLQLDNANHLKTQI 146
            L+ T  EL+   E +   +  +EL+  K   ++ +   L + ++ V+ +LD A       
Sbjct  50   LKGTEDELDKYSEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATA 109
Query  147  AQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARLELERQLTKANGDA 206
             Q+LE+     +E ER    +EN A   E ++E  ++QL E      E +R+      + 
Sbjct  110  LQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYE----EV 165
Query  207  ASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQ-------KSRL 259
            A      E EL+   +E  EL      K +E EE+L+ + N   SLE Q       + + 
Sbjct  166  ARKLVIVEGELE-RTEERAELSE---GKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKY 221
Query  260  QSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKEL 312
            + E++VL   L++A   A+  E+ VA+LEK   DL+++L    +  +   +EL
Sbjct  222  EEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYSQKLKYKAISEEL 274

Sequence Alignment: 30. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 53.8 bits 208,  Expect = 2e-08
 Identities = 58/258 22%, Positives = 123/258 47%, Gaps = 6/258 2%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA        QQ  D   R E+ E +   L+   + +E +L+  +  L 
Sbjct  6    KKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALM 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMAQK---ISEYEE 240
              +    E E+ L  A  + A+   +    E +L+   + +     K+++      E E 
Sbjct  66   AVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  + E++   L+++++      E+A +   ++ +++A +E      + + E 
Sbjct  126  ARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAEA 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
                + + ++ELRV    L+ L+   EK   + ++   + K LT  L EA+++   A R 
Sbjct  186  GEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERS 245
Query  361  IHEQEIEIKRLENERDELSAAYKE 384
            +++ + E+ RLE+E       Y+E
Sbjct  246  VQKLQKEVDRLEDELVMEKEKYRE 269

Sequence Alignment: 31. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 53.6 bits 207,  Expect = 2e-08
 Identities = 62/256 24%, Positives = 124/256 48%, Gaps = 10/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA         Q  D   R E+ E +  +L+   +T+E +L+  + Q +
Sbjct  6    KKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQTQGQ-E 64
Query  187  EESEARLE-LERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEY------- 238
                 +LE  E+ L  A  + A+   + +  L    D  EE       K+SE        
Sbjct  65   TLVNGKLEGKEKALQNAESEVAALNRRIQL-LGEDLDRSEERLASATAKLSEASAAADES 123
Query  239  EEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKL 298
            E   + L N+  + E++   L+++++      E+A +   ++ +++A +E      + + 
Sbjct  124  ERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERA 183
Query  299  EEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAH 358
            E     + + ++ELRV    L+ L+   EK   + ++   + K LT  L EA+++   A 
Sbjct  184  EAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 243
Query  359  RRIHEQEIEIKRLENERDELSAAYKE 384
            R +++ + E+ RLE+E       Y+E
Sbjct  244  RSVQKLQKEVDRLEDELVSEKEKYRE 269

Sequence Alignment: 32. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 52.2 bits 201,  Expect = 6e-08
 Identities = 73/260 28%, Positives = 135/260 51%, Gaps = 22/260 8%
Query  54   KSDKEKQKFQAEVFELLAQL-ETANKEKLTALKNVEK-LEYTVHELNIKIEEIN--RTVI 109
            K DKE    +AE  EL  ++ E   K+    L  ++K L+ T  E++   E +   +  +
Sbjct  12   KGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKYSEALKDAQEKL 71
Query  110  ELTSHKQRLSQ-ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLE 168
            EL+  K   ++ E   L + ++ ++ +LD A        Q+LE+   + +E ER    +E
Sbjct  72   ELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQADESERGMKVIE 131
Query  169  NHAHTLEVELESLKVQLDEESEARLELERQLTKANGDAASWKSKYE-AELQAHADEVEEL 227
            N A   E ++E  ++QL E  +   + +R+  +        + + E AE +A   EV EL
Sbjct  132  NRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAEERA---EVSEL 188
Query  228  RRKMAQKISEYEEQLEALLNKCSSLEKQ-------KSRLQSEVEVLIMDLEKATRHAQQL 280
                  K  + EE+L+ + N   SLE Q       + + + E+ +L   L++A   A+  
Sbjct  189  ------KSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAEFA 242
Query  281  EKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKL 322
            EK V++LEK   DL+++L    + ++   +EL   + ++  L
Sbjct  243  EKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMTTL 284

Sequence Alignment: 33. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 52.0 bits 200,  Expect = 7e-08
 Identities = 67/240 27%, Positives = 132/240 55%, Gaps = 28/240 11%
Query  134  LQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEA-- 191
            L+LD  N L    A+  E  +   E++ ++   LE+    L+ +L+  + +LD+ SE+  
Sbjct  11   LKLDKENALDR--AEGAEGDKKAAEDKSKQ---LEDDLVALQKKLKGTEDELDKYSESLK 65
Query  192  ----RLEL-ERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALL 246
                +LE+ E+  T A  D AS   +    +Q   +E++  + ++A  +++ EE  +A  
Sbjct  66   DAQEKLEVAEKTATDAEADVASLNRR----IQLVEEELDRAQERLATALTKLEEAEKAAD 121
Query  247  NKCSSL---EKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEK----INLDLKNKLE 299
                 +   E + S+ + ++E+  + L++A   A++ +++  ++ +    I  DL+ + E
Sbjct  122  ESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLE-RTE 180
Query  300  EVTMLME----QAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLN 355
            E   L E    + ++EL+     L+ L+ + EK   + D+   E K LTD L EA+++  
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  356  DAHRRIHEQEIEIKRLENERDELSAAYK 383
             A R + + E  I  LE+E       YK
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYK 268

Sequence Alignment: 34. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 52.0 bits 200,  Expect = 7e-08
 Identities = 71/274 25%, Positives = 140/274 51%, Gaps = 20/274 7%
Query  1    MNKKRDSELA-KLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEK 59
            M+  +   LA K+ K  E+    +E+  + LR   +   + +++ L+ LQK     + + 
Sbjct  1    MDAIKKKMLAMKMEK--ENAVDRAEQNEQKLRDTEEQKAK-IEEDLNNLQKKCANLENDF 57
Query  60   QKFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLS 119
                 ++ E + +LET+ K ++T ++  +++  T  ++ +  E++ R    L +  +RL 
Sbjct  58   DNVNEQLQEAMTKLETSEK-RVTEME--QEVSGTTRKITLLEEDLERNEERLQTATERLE 114
Query  120  Q-----ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTL 174
            +     + +E  ++V E +   D+      Q+  QL++ ++  E+ ERK           
Sbjct  115  EASKAADESERGRKVLESRSLADDER--IDQLEAQLKEAKYIAEDAERKYDEAARKLAIT 172
Query  175  EVELESLKVQLDEESEAR-LELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQ 233
            EV+LE  + +L E +EA+ LELE +L K  G+        E E     D  EE  R + Q
Sbjct  173  EVDLERAEARL-EAAEAKILELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDLTQ 230
Query  234  KISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQL 287
            ++ + E +        S L+K+  RL+ E   L+ + EK    + +L++  A+L
Sbjct  231  RLKDAENRATEAERTVSKLQKEVDRLEDE---LLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 35. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 52.0 bits 200,  Expect = 7e-08
 Identities = 72/272 26%, Positives = 144/272 52%, Gaps = 46/272 16%
Query  318  ELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDE 377
            ++Q ++ E +   D+ D    + +++TD L   + +L D ++++ + E +   L+  +++
Sbjct  7    KMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTEND---LDKAQED 63
Query  378  LSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNM 437
            LS A    E    ++E K Q   AE+A +     +R+   +EE+E   ++ ++  E+L  
Sbjct  64   LSVANSNLE----EKEKKVQEAEAEVAAL----NRRMTLLEEELERAEERLKLATEKL-- 113
Query  438  RLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYD 497
               E       E  R++K  + +      S+    +AN  ++  +K+  +   E    YD
Sbjct  114  ---EEATHTADESERVRKVMENR------SFQDEERANT-VESQLKEAQMLAEEADRKYD 163
Query  498  EVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQAEQLHEEAVVRVNELTT 557
            EV R+L                ++A+LE    A E+A   + +  +L EE  V  N L +
Sbjct  164  EVARKLAM--------------VEADLER---AEERAEAGENKIVELEEELRVVGNNLKS 206
Query  558  INVNLASA---KSKLESEFSALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEEQER 614
            + V+   A   +   E +   + A   E       ++  VQKL  E+   +D L+ E+ER
Sbjct  207  LEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKER 266
Query  615  LVKLETVKKSLEQEVRTL 632
                +++ + L+Q  + L
Sbjct  267  ---YKSISEELDQTFQEL 281

Sequence Alignment: 36. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 51.3 bits 197,  Expect = 1e-07
 Identities = 63/251 25%, Positives = 127/251 50%, Gaps = 8/251 3%
Query  132  VKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEA 191
            +KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L + +  
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  192  RLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEEQLEAL 245
              E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E   + L
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  246  LNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLM 305
             N+  S E++   L+++++      E+A R   ++ +++A +E      + + E      
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  306  EQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHRRIHEQ 364
             + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R +++ 
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
Query  365  EIEIKRLENERDELSAAYK 383
            + E+ RLE+E       YK
Sbjct  240  QKEVDRLEDELVNEKEKYK 258

Sequence Alignment: 37. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 50.4 bits 193,  Expect = 2e-07
 Identities = 71/264 26%, Positives = 132/264 50%, Gaps = 33/264 12%
Query  242  LEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEV 301
            +EA+  K  +++ +K     + + L      A R A ++ + V  L+K    ++  +   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  302  TMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDD-LAEAKSQLNDAHRR 360
               +  A K L  K   L   + E   L +++ Q+  EN + +++ L  A ++L +A   
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASL-NRKVQMIEENLERSEERLGTALTKLGEASHA 119
Query  361  IHEQEIEIKRLEN------ER-DELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYE-- 411
              E     K LEN      ER D+L+   KEA  L +  + K+  +  ++AQV  D E  
Sbjct  120  ADEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVA 179
Query  412  -KRLAQKDEEIEALRKQYQIEIEQL-NMRLAEAEAKLKTEIARLKKKYQAQITELELSLD 469
              R+   D +I  L ++ ++    L ++ ++E +A  + E      +Y+ QI  L + L 
Sbjct  180  EDRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVE------EYKRQIKTLTVKLK 233
Query  470  AANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEE 526
             A       +K +KK       LQ   D +        D+LG+ + R +AL  E+++
Sbjct  234  EAEARAEYAEKYVKK-------LQKEVDRLE-------DELGINKDRYRALADEMDQ 276

Sequence Alignment: 38. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 50.2 bits 192,  Expect = 3e-07
 Identities = 72/274 26%, Positives = 139/274 50%, Gaps = 20/274 7%
Query  1    MNKKRDSELA-KLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEK 59
            M+  +   LA K+ K  E+    +E+  + LR   +   + +++ L+ LQK     + + 
Sbjct  1    MDAIKKKMLAMKMEK--ENAVDRAEQNEQKLRDTEEQKAK-IEEDLNNLQKKCANLENDF 57
Query  60   QKFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLS 119
                 ++ E +A+LET+ K ++T ++  +++  T  ++ +  E++ R    L +  +RL 
Sbjct  58   DNVNEQLQEAMAKLETSEK-RVTEME--QEVSGTTRKITLLEEDLERNEERLQTATERLE 114
Query  120  Q-----ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTL 174
            +     + +E    V E +   D+      Q+  QL++ ++  E+ ERK           
Sbjct  115  EASKAADESERGARVLESRSLADDER--IDQLEAQLKEAKYIAEDAERKYDEAARKLAIT 172
Query  175  EVELESLKVQLDEESEAR-LELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQ 233
            EV+LE  + +L E +EA+ LELE +L K  G+        E E     D  EE  R + Q
Sbjct  173  EVDLERAEARL-EAAEAKILELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDLTQ 230
Query  234  KISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQL 287
            ++ + E +        S L+K+  RL+ E   L+ + EK    + +L++  A+L
Sbjct  231  RLKDAENRATEAERTVSKLQKEVDRLEDE---LLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 39. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 49.9 bits 191,  Expect = 3e-07
 Identities = 69/256 26%, Positives = 132/256 51%, Gaps = 26/256 10%
Query  193  LELERQLTKANGDAASWKSKYEAELQAHA--DEVEELRRKMAQKISEYEEQLEALLNKCS 250
            ++LE+       D    ++K EA L+A    +EV EL +++ Q ++E  E+++  L + +
Sbjct  11   MKLEKDNAADKADTCENQAK-EANLRADKIMEEVAELTKRLTQ-VTEDHEKFKNTLEQAN 68
Query  251  SLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQK 310
               ++K +L +  E  +  L   TR  QQ+E+ + + E+ +    +KL E T   ++  +
Sbjct  69   KDLEEKEKLLTSTEANVAAL---TRKVQQVEEDLEKSEERSGAALSKLLEATQSADENNR 125
Query  311  ELRVKIAELQKLQHEYEKLRDQRDQ---LARENKKLTDD----LAEAKSQLNDAHRRIHE 363
              +V     Q+ +   ++L +Q  +   LA +    +D+    LA  + +L  A  R+  
Sbjct  126  MCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVKS 185
Query  364  QEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEEIEA 423
             E +I  LE   +EL       ++L   E+  NQR + E+ +      K L  K +E E 
Sbjct  186  GEAKIMELE---EELKVVGNSLKSLEVSEDKANQR-VEEFKR----QLKSLTIKLKEAET 237
Query  424  LRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELE 465
              +  +  +++L   +   E KL  E    K KY+A   +L+
Sbjct  238  RAENAEKNVKKLQKEVDRLEDKLMNE----KDKYKAICDDLD 275

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 49.6 bits 189,  Expect = 3e-07
 Identities = 66/202 32%, Positives = 113/202 55%, Gaps = 31/202 15%
Query  212  KYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLE 271
            KY+ E Q   +E E+   +  Q+I     +++ LL +   +E+ + RLQ+  E     LE
Sbjct  12   KYQ-ECQTKMEEAEKTASEAEQEIQSLNRRIQ-LLEE--DMERSEERLQTATE----KLE 63
Query  272  KATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRD 331
            +A++ A + E+    LE +N    N  EE T ++E+   E ++ IAE      E +K   
Sbjct  64   EASKAADESERNRKVLENLN----NASEERTDVLEKQLTEAKL-IAE------EADK--- 109
Query  332  QRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQ 391
            + D+ AR+      DL  A+++L  A  ++ E E E+K + N    L  + +EA     Q
Sbjct  110  KYDEAARKLAITEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEA----SQ 165
Query  392  EEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQL-NMRLAEAE 443
             E   +  I +L Q   D E R  + +  +  L+K    E+++L +  LAE E
Sbjct  166  REDSYEETIRDLTQRLKDAENRATEAERTVSKLQK----EVDRLEDELLAEKE 214

Sequence Alignment: 41. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 49.7 bits 190,  Expect = 3e-07
 Identities = 86/250 34%, Positives = 129/250 51%, Gaps = 37/250 14%
Query  56   DKEKQKFQAEVFE---LLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELT 112
            D  K K QA  +E    + + E A ++   A    EK E  V  L  KI++I     EL 
Sbjct  2    DAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIEN---ELD 58
Query  113  SHKQRLSQENTELIKEVHEVKLQLDNAN--HLKTQIAQQLEDTRHRLEEEER-KRASLEN 169
              ++ L+Q  T+L  E  E  LQ   A+   L  +I Q +E+   R EE  +   A LE 
Sbjct  59   QVQENLTQATTKL--EEKEKALQTAEADVAALNRRI-QLIEEDLERSEERLKVATAKLEE 115
Query  170  HAHTLEVELESLKVQLDEES---EARLE-LERQLTKANGDAASWKSKYE------AELQA 219
             +H+ + E E ++  L+  S   E R++ LE QL +A   A     KY+      A ++A
Sbjct  116  ASHSAD-ESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEA 174
Query  220  HADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQS-----EVEVLIMD----- 269
              +  EE       KI E EE+L  + N   SLE  + + Q      E ++ IM      
Sbjct  175  DLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKE 234
Query  270  ----LEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKEL 312
                 E A R  Q+L+K V +LE   +  K K E ++  ++Q   EL
Sbjct  235  AEARAEFAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAEL 281

Sequence Alignment: 42. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 49.7 bits 190,  Expect = 3e-07
 Identities = 75/266 28%, Positives = 140/266 52%, Gaps = 42/266 15%
Query  76   ANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQ 135
            A K+K+ A+K  +K     + L+ + E++ + + E    K ++  +   L+K+  + +  
Sbjct  3    AIKKKMVAMKMEKK-----NALD-RAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTEND 56
Query  136  LDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARLEL 195
             DN N        QL+D + + E  E++   ++ H    E E++SL  ++    E  ++ 
Sbjct  57   YDNCN-------TQLQDVQAKYERAEKQ---IQEH----EQEIQSLTRKISLLEEGIMKA 102
Query  196  ERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQ 255
            E ++T A+G       K E   +A ADE E  R+ +    S  +E+++        LEKQ
Sbjct  103  EERFTTASG-------KLEEASKA-ADESERNRKVLENLNSGNDERID-------QLEKQ 147
Query  256  KSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVK 315
             +  +   E      E+A R     E     LE+    L+    +V  L EQ    L V 
Sbjct  148  LTEAKWIAEEADKKYEEAARKLAITE---VDLERAEARLEAAEAKVIDLEEQ----LTVV 200
Query  316  IAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENER 375
             A ++ LQ + ++   + D      + LT+ L +A+++  +A R + + + E+ RLE+E 
Sbjct  201  GANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQKEVDRLEDEL 260
Query  376  DELSAAYK 383
                  YK
Sbjct  261  LTEKEKYK 268

Sequence Alignment: 43. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 49.5 bits 189,  Expect = 4e-07
 Identities = 67/271 24%, Positives = 129/271 47%, Gaps = 19/271 7%
Query  30   LRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQKFQAEVFELLAQLETANKEKLTALKNVEK 89
            +++K QA   E  + LD+   A+ K  +   K++     +  +L    K+ +    +++K
Sbjct  4    IKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLE----RIEEELRDTQKKMMQTENDLDK 59
Query  90   LEYTVHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQLDNANHLKTQIAQQ 149
             +  +   N  +EE  + V E  +    L++  T L +E+   +        LK   A+ 
Sbjct  60   AQEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAE------ERLKLATAK- 112
Query  150  LEDTRHRLEEEERKRASLENH-------AHTLEVELESLKVQLDEESEARLELERQLTKA 202
            LE+  H  +E ER R  +EN        A+T+E +L+  ++  +E      E+ R+LT  
Sbjct  113  LEEATHTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMV 172
Query  203  NGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSE 262
              D    + + E   +    E+EE  R +   +   E   E  L +  S E+Q   + + 
Sbjct  173  EADLERAEERAETG-ENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSAR 231
Query  263  VEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKEL 312
            ++      E A R  Q+L+K V +LE   +  K + + ++  ++Q  +EL
Sbjct  232  LKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281

Sequence Alignment: 44. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 48.8 bits 186,  Expect = 7e-07
 Identities = 64/256 25%, Positives = 137/256 53%, Gaps = 25/256 9%
Query  411  EKRLAQKDEEIEALRKQYQIEIEQLNMRLAEA-EAKLKTEIARLKKKYQAQITELELSLD 469
            +K LA K E+  AL +  Q+E     +R  E  + K++ ++  L+KK+      LE  +D
Sbjct  6    KKMLAMKMEKENALDRAEQVE---QKLRDCECNKNKVEEDLNNLQKKFAI----LENDFD 58
Query  470  AANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRI 529
            + N+  +D    ++    +  E+++    ++R++Q   + L  ++ R Q+   +LEE   
Sbjct  59   SINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASK 118
Query  530  ALEQANRAKRQAEQLHEEAVVRVN----ELTTINVNLASAKSKLES---EFSALQADYDE 582
            A +++ R ++  E        R++    +L         A+ K++    +++  + D + 
Sbjct  119  AADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLER 178
Query  583  VHKELRISDERVQKLTIELK----STKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEE 638
                L  ++ ++ +L  ELK    + K L I EQE   +    + S E+ +R L  R+++
Sbjct  179  AEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQR----EDSYEETIRDLTQRLKD 234
Query  639  VEANALAGGKRVIAKLESRIRDVEIEVEEERRRH-AETDKM 678
             E N  +  +R ++KL+  +  +E E+  E+ R+ A +D++
Sbjct  235  AE-NRASEAERTVSKLQKEVDRLEDELLAEKERYKATSDEL 274

Sequence Alignment: 45. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 47.3 bits 179,  Expect = 2e-06
 Identities = 70/220 31%, Positives = 128/220 58%, Gaps = 43/220 19%
Query  224  VEELRRKM-AQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEK 282
            ++ +++KM A K+ +      ALL  C    +Q++R  +      +  EKA   A+ L+K
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALL--C----EQQARDAN------LRAEKAEEEARSLQK 48
Query  283  RVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKK 342
            ++ Q+E    DL   +E+   LM Q   +L  K   LQ  + E   L ++R QL  E+ +
Sbjct  49   KIQQIEN---DLDQTMEQ---LM-QVNAKLDEKDKALQNAESEVAAL-NRRIQLLEEDLE 100
Query  343  LTDD-LAEAKSQLNDAHRRIHEQE-----IEIKRLENER--DELSAAYKEAETLRKQEEA 394
             +++ LA A ++L +A +   E E     +E K L +E   D L    KEA  + ++ + 
Sbjct  101  RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADK 160
Query  395  KNQRLIAELAQVRHDYEK----------RLAQKDEEIEALR---KQYQIEIEQLNMRLAE 441
            K   +  +LA V  D E+          ++ + +EE+  +    K  ++  E+ N+R  E
Sbjct  161  KYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEE 220
Query  442  AEAKLKTEIARLKK-KYQAQITE 463
             + ++KT   RLK+ + +A+  E
Sbjct  221  YKQQIKTLTTRLKEAEARAEFAE 243

Sequence Alignment: 46. Allergen Name: Hom s 5 Sequence ID: P02538

 Score = 46.1 bits 175,  Expect = 9e-06
 Identities = 89/356 25%, Positives = 171/356 48%, Gaps = 36/356 10%
Query  94   VHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQ--LDNANHLKTQIAQQLE 151
            ++E+ +    +    +++    QR+  E  E IK ++  K+   +D    L+ Q   ++ 
Sbjct  135  IQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNN-KFASFIDKVRFLEQQ--NKVL 191
Query  152  DTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARLELERQLTKANGDAASWKS 211
            +T+  L +E+  +   +N    +E  + +L+ QLD     R  L+ +L         +K+
Sbjct  192  ETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKN 251
Query  212  KYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLE 271
            KYE E+        E+        + Y  ++E L  K  +L  + + L++  +    +L 
Sbjct  252  KYEDEINKRTAAENEFVTLKKDVDAAYMNKVE-LQAKADTLTDEINFLRALYDA---ELS 307
Query  272  KATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRD 331
            +   H       ++     NLDL + + EV    E+  +  R + AE    Q +YE+L  
Sbjct  308  QMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAE-AE-SWYQTKYEEL-- 363
Query  332  QRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQ 391
               Q+     +  DDL   K ++ + +R I+    EI  ++ +   L AA  +AE  R +
Sbjct  364  ---QVT--AGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQ-RGE 417
Query  392  EEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIA 451
               K+ +   E        E  L +  +++  L K+YQ   E +N++LA     L  EIA
Sbjct  418  MALKDAKNKLE------GLEDALQKAKQDLARLLKEYQ---ELMNVKLA-----LDVEIA 463
Query  452  RLKKKYQAQITELELSLDAANKANIDL-QKTI 482
              +K  + +  E  L+ +   + NI + Q T+
Sbjct  464  TYRKLLEGE--ECRLNGEGVGQVNISVVQSTV 493

Sequence Alignment: 47. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 43.3 bits 162,  Expect = 3e-05
 Identities = 64/256 25%, Positives = 128/256 50%, Gaps = 8/256 3%
Query  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
            K+++ +KL+ DNA      + QQ ++   R E+ E +  + +   + +E EL+  + QL 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
Query  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEE 240
              +    E E+ L  A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  66   AANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
Query  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAES 185
Query  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREETYKEQIKTLANKLKAAEARAEFAER 244
Query  360  RIHEQEIEIKRLENERDELSAAYK 383
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVNEKEKYK 268

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.