The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MPIEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTE
IKFKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVT
ASVGDVTSVRTYKRI
Sequence Info Allergen Name Length Opt Bits Score E Value
Q17284 Blo t 13 135 859 203.2 2.1e-54
E0A8N8 Der p 13.0101 131 675 161.2 8.3e-42
AAP35078 Der f 13.0101 131 671 160.3 1.6e-41
Q9U5P1 Lep d 13 131 664 158.7 4.7e-41
ABL09307 Aca s 13 131 526 127.3 1.4e-31
AAU11502 Tyr p 13 131 521 126.1 3.1e-31
Q1KS35 Pen m 13.0101 136 382 94.4 1.1e-21
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 13 Sequence ID: Q17284

 Score = 203.2 bits 859,  Expect = 2e-54
 Identities = 135/135 100%, Positives = 135/135 100%, Gaps = 0/135 0%
Query  1    MPIEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTE 60
            MPIEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTE
Sbjct  1    MPIEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTE 60
Query  61   IKFKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVT 120
            IKFKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVT
Sbjct  61   IKFKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVT 120
Query  121  ASVGDVTSVRTYKRI 135
            ASVGDVTSVRTYKRI
Sbjct  121  ASVGDVTSVRTYKRI 135

Sequence Alignment: 2. Allergen Name: Der p 13.0101 Sequence ID: E0A8N8

 Score = 161.2 bits 675,  Expect = 8e-42
 Identities = 108/128 84%, Positives = 120/128 93%, Gaps = 5/128 3%
Query  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
            IEGKYKLEKS+ FD+FLD+LGVGFMVKTAAKTLKPT+EV  + D YVFRSLSTFKNTEIK
Sbjct  4    IEGKYKLEKSEKFDEFLDKLGVGFMVKTAAKTLKPTFEVAKENDQYVFRSLSTFKNTEIK 63
Query  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVTAS 122
            FKLGEEFEEDRADGKRVKTV+NK+GDNKF+QTQ+GDKEVKIVR+F+     GD+VVVTAS
Sbjct  64   FKLGEEFEEDRADGKRVKTVINKDGDNKFVQTQFGDKEVKIVREFN-----GDEVVVTAS 118
Query  123  VGDVTSVRTYKRI 135
               VTSVRTYKRI
Sbjct  119  CDGVTSVRTYKRI 131

Sequence Alignment: 3. Allergen Name: Der f 13.0101 Sequence ID: AAP35078

 Score = 160.3 bits 671,  Expect = 2e-41
 Identities = 105/128 82%, Positives = 119/128 92%, Gaps = 5/128 3%
Query  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
            IEGKYKLEKS+ FD+FLD+LGVGFMVKTAAKTLKPT+EV ++ D Y+FRSLSTFKNTE K
Sbjct  4    IEGKYKLEKSEKFDEFLDKLGVGFMVKTAAKTLKPTFEVAIENDQYIFRSLSTFKNTEAK 63
Query  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVTAS 122
            FKLGEEFEEDRADGKRVKTV+ KEGDNKF+QTQ+GDKEVKI+R+F+     GD+VVVTAS
Sbjct  64   FKLGEEFEEDRADGKRVKTVIQKEGDNKFVQTQFGDKEVKIIREFN-----GDEVVVTAS 118
Query  123  VGDVTSVRTYKRI 135
               VTSVRTYKRI
Sbjct  119  CDGVTSVRTYKRI 131

Sequence Alignment: 4. Allergen Name: Lep d 13 Sequence ID: Q9U5P1

 Score = 158.7 bits 664,  Expect = 5e-41
 Identities = 104/127 81%, Positives = 119/127 93%, Gaps = 5/127 3%
Query  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
            I G+YKL+KS+NFD+FLD+LGVGF+VKTAAKT+KPTLEV V GDTY+FRSLSTFKNTEIK
Sbjct  4    IAGQYKLDKSENFDQFLDKLGVGFLVKTAAKTVKPTLEVAVDGDTYIFRSLSTFKNTEIK 63
Query  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVTAS 122
            FKLGEEFEEDRADGKRVKTV+ K+GDNKF+QTQYGDKEVK+VR+F     +GD+V VTAS
Sbjct  64   FKLGEEFEEDRADGKRVKTVIVKDGDNKFVQTQYGDKEVKVVREF-----KGDEVEVTAS 118
Query  123  VGDVTSVRTYKR 134
            V  VTSVR YKR
Sbjct  119  VDGVTSVRPYKR 130

Sequence Alignment: 5. Allergen Name: Aca s 13 Sequence ID: ABL09307

 Score = 127.3 bits 526,  Expect = 1e-31
 Identities = 86/127 67%, Positives = 100/127 78%, Gaps = 5/127 3%
Query  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
            I G YKLEKSDNFD FL ELG+ F+ +  AK+  PT+EV V GD+Y  ++ ST+KNTEI 
Sbjct  4    INGSYKLEKSDNFDAFLKELGLNFVTRNLAKSATPTVEVSVNGDSYTIKTASTLKNTEIS 63
Query  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVTAS 122
            FKLGEEFEE RADGK VKTVVNKE D KF+Q Q GDKEV IVR+FS   D+G  + VTA+
Sbjct  64   FKLGEEFEEARADGKTVKTVVNKESDTKFVQVQQGDKEVTIVREFS---DEG--LTVTAT 118
Query  123  VGDVTSVRTYKR 134
            V  VTSVR YKR
Sbjct  119  VNGVTSVRFYKR 130

Sequence Alignment: 6. Allergen Name: Tyr p 13 Sequence ID: AAU11502

 Score = 126.1 bits 521,  Expect = 3e-31
 Identities = 83/127 65%, Positives = 101/127 79%, Gaps = 5/127 3%
Query  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
            + G YKLEKSDNFD FL ELGV F+ +  AK+  PT+EV V GD+Y  ++ ST+KN+EIK
Sbjct  4    LNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNSEIK 63
Query  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVTAS 122
            FKLGEEFEEDRADGK+V+T V KEGDNK++Q Q GDK V IVR+FSE+      + VTA+
Sbjct  64   FKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEE-----GLTVTAT 118
Query  123  VGDVTSVRTYKR 134
            V  VTSVR YKR
Sbjct  119  VNGVTSVRFYKR 130

Sequence Alignment: 7. Allergen Name: Pen m 13.0101 Sequence ID: Q1KS35

 Score = 94.4 bits 382,  Expect = 1e-21
 Identities = 60/127 47%, Positives = 91/127 71%, Gaps = 11/127 8%
Query  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
            IEGK+K+E S+NFD+F+  LGVG++++       PT+E+   GDTY  ++ +TFK TEIK
Sbjct  4    IEGKFKMESSENFDEFMKALGVGLVMRKMGNAATPTVEITKDGDTYAMKTTTTFKTTEIK 63
Query  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVK-----IVRDFSEQIDQGDDV 117
            FKLGEEFEE  ADG+ VK+ +  +G NK+++ Q GDKE K     ++R+F++     D +
Sbjct  64   FKLGEEFEETTADGRVVKSTITLDG-NKLVHKQVGDKEKKEKDSELLREFTD-----DKM 117
Query  118  VVTASVGDVTSVRTYKRI 135
            ++   V D+   R Y R+
Sbjct  118  LMECKVDDIVCKRVYSRL 135

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.